[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS82142.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bi3A.bssp"
#ERROR : Can't open dsspfile "1c0wA.bssp"
#ERROR : Can't open dsspfile "1b9nA.bssp"
#ERROR : Can't open dsspfile "1b9mB.bssp"
#ERROR : Can't open dsspfile "1b9nB.bssp"
#ERROR : Can't open dsspfile "1b9mA.bssp"
#ERROR : Can't open dsspfile "1bi2A.bssp"
#ERROR : Can't open dsspfile "1bi1A.bssp"
#ERROR : Can't open dsspfile "1c0wC.bssp"
#ERROR : Can't open dsspfile "3df8A.bssp"
#ERROR : Can't open dsspfile "1a40A.bssp"
#ERROR : Can't open dsspfile "3e6mF.bssp"
#ERROR : Can't open dsspfile "1cy0A.bssp"
#ERROR : Can't open dsspfile "3bj6B.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "3cjnA.bssp"
#ERROR : Can't open dsspfile "3e6mB.bssp"
#ERROR : Can't open dsspfile "1dtr-.bssp"
#ERROR : Can't open dsspfile "1a54A.bssp"
#ERROR : Can't open dsspfile "1ddnA.bssp"
#ERROR : Can't open dsspfile "1bi3B.bssp"
#ERROR : Can't open dsspfile "2bv6A.bssp"
#ERROR : Can't open dsspfile "1cy8A.bssp"
#ERROR : Can't open dsspfile "1c0wB.bssp"
#ERROR : Can't open dsspfile "1bi2B.bssp"
#ERROR : Can't open dsspfile "3broC.bssp"
#ERROR : Can't open dsspfile "3echA.bssp"
#ERROR : Can't open dsspfile "3broA.bssp"
#ERROR : Can't open dsspfile "1al3A.bssp"
#ERROR : Can't open dsspfile "1dprA.bssp"
#ERROR : Can't open dsspfile "1cy6A.bssp"
#ERROR : Can't open dsspfile "3e6mE.bssp"
#ERROR : Can't open dsspfile "3deuA.bssp"
#ERROR : Can't open dsspfile "3bpxA.bssp"
#ERROR : Can't open dsspfile "3broB.bssp"

## Summary of PDB Search
:285
    1e-10   8%  1bi3A  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    2e-10   9%  1c0wA  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    7e-09  20%  1b9nA  [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
    2e-08  24%  1b9mB  [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
    1e-07  11%  1b9nB  [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
    7e-07  24%  1b9mA  [a.4.5 - b.40.6 - b.40.6] PROTEIN (MODE)
    2e-06   9%  1bi2A  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    3e-06   9%  1bi1A  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    4e-05  24%  1c0wC  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    6e-05  11%  3df8A  [x.x.x] POSSIBLE HXLR FAMILY TRANSCRIPTIONAL FACTOR
    7e-05  14%  1a40A  [x.x.x] PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
    7e-05  11%  3e6mF  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    1e-04  15%  1cy0A  [e.10.1] DNA TOPOISOMERASE I
    1e-04   5%  3bj6B  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    1e-04  33%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    1e-04  14%  3cjnA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    1e-04  11%  3e6mB  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    1e-04  24%  1dtr-  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    2e-04  13%  1a54A  [c.94.1] PHOSPHATE-BINDING PROTEIN
    2e-04  24%  1ddnA  [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
    2e-04  20%  1bi3B  [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
    2e-04  14%  2bv6A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA
    3e-04  17%  1cy8A  [e.10.1] DNA TOPOISOMERASE I
    3e-04   9%  1c0wB  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    4e-04  19%  1bi2B  [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
    4e-04   8%  3broC  [x.x.x] TRANSCRIPTIONAL REGULATOR
    5e-04  13%  3echA  [x.x.x] MULTIDRUG RESISTANCE OPERON REPRESSOR
    5e-04   8%  3broA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    5e-04  19%  1al3A  [x.x.x] CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB
    6e-04  25%  1dprA  [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
    6e-04  15%  1cy6A  [e.10.1] DNA TOPOISOMERASE I
    6e-04  11%  3e6mE  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    7e-04  16%  3deuA  [x.x.x] TRANSCRIPTIONAL REGULATOR SLYA
    8e-04   8%  3bpxA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    8e-04   9%  3broB  [x.x.x] TRANSCRIPTIONAL REGULATOR
:285

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGDXXXXXXXXXX
1bi3A           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKH
1c0wA           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKH
1b9nA           ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINENQLSEHILVERATGAVLTRYG-----------
1b9mB           ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINE--------------------------------
1b9nB           ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVEAVLTRYGQRLIQLYDLLAQIQ
1b9mA           ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAIN---------------------------------
1bi2A           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKH
1bi1A           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKH
1c0wC           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVA---------------------------------
3df8A           YTLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIK---------------------------------
1a40A           ----------------------------------------------------------------------
3e6mF           LPTPKLRLLSSLSAYGELVGQLATLGVEQSTTSRTVD---------------------------------
1cy0A           LTPAQFTKPPARFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYAEKMG-----------
3bj6B           VTVGQRAILEGLSLTPGAAPQLGAALQKRQYISRILQ---------------------------------
1biaA           -NTVPLKALLANGEFHSGEQLGETLGMSRAAINKHIQ---------------------------------
3cjnA           -TAKRALAILSAKDGLPIGTLGIFAVVEQSTLSRALD---------------------------------
3e6mB           LPTPKLRLLSSLSAYGELVGQLATLGVEQSTTSRTVD---------------------------------
1dtr-           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVA---------------------------------
1a54A           ----------------------------------------------------------------------
1ddnA           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVA---------------------------------
1bi3B           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTG-----------
2bv6A           LTYPQFLVLTILWDESNVKKVVTELALDTGTVSPLLK---------------------------------
1cy8A           -----------RFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYAEKMG-----------
1c0wB           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKH
1bi2B           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT------------
3broC           TQTIIDYLSRNKNKEVLQRDLESEFSIKSSTATVLLQ---------------------------------
3echA           LTPPDVHVLKLIDEQRGL-NLQDLGRQMCALITRKIRE----LEGRNLVRRQLFLTDEG-----------
3broA           TQTIIDYLSRNKNKEVLQRDLESEFSIKSSTATVLLQ---------------------------------
1al3A           ----------------------------------------------------------------------
1dprA           MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTV----------------------------------
1cy6A           LTPAQHFTKPPRFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYAEKMG-----------
3e6mE           LPTPKLRLLSSLSAYGELVGQLATLGVEQSTTSRTVD---------------------------------
3deuA           THWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQ--LEDKGLISRQKRIKLTEKA-----------
3bpxA           LTDAQVACLLRIHREPKQDELATFFHVDKGTIARTLRR--------------------------------
3broB           ---IIDYLSRNKNKEVLQRDLESEFSIKSSTATVLLQ---------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXVRRAGQEALRFGVPENXXXXXXXXXXXXRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAG
1bi3A           RLAERLLTDIIGLDINHDEARWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSM
1c0wA           RLAERLLTDIIGLDINKEACRWEHVMSDEVERRLVKVLKDV--SRSPFGNPIPGLDELGVIVQINEIFQV
1b9nA           ----------------------------------------------------------------------
1b9mB           ----------------------------------------------------------------------
1b9nB           QKAFDVLSDDDALPLNSLLAAIS-RFSLQTSARNQWFGTITAQHVDVLLADGKTRLKVAITAQSGLDEGK
1b9mA           ----------------------------------------------------------------------
1bi2A           RLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAA
1bi1A           RLAERLLTDIIGLDINKVHDEARWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAAT
1c0wC           ----------------------------------------------------------------------
3df8A           ----------------------------------------------------------------------
1a40A           --------------EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASD
3e6mF           ----------------------------------------------------------------------
1cy0A           ----------------------------------------------------------------------
3bj6B           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
3cjnA           ----------------------------------------------------------------------
3e6mB           ----------------------------------------------------------------------
1dtr-           ----------------------------------------------------------------------
1a54A           --------------EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASD
1ddnA           ----------------------------------------------------------------------
1bi3B           ----------------------------------------------------------------------
2bv6A           ----------------------------------------------------------------------
1cy8A           ----------------------------------------------------------------------
1c0wB           RLAERLLTDIDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFNPIPGLDELGVAPGTRVIDAATSM
1bi2B           ----------------------------------------------------------------------
3broC           ----------------------------------------------------------------------
3echA           ----------------------------------------------------------------------
3broA           ----------------------------------------------------------------------
1al3A           --------------------------------------------LHMHQGSPTQIAEAVSKGNADFAIAE
1dprA           ----------------------------------------------------------------------
1cy6A           ----------------------------------------------------------------------
3e6mE           ----------------------------------------------------------------------
3deuA           ----------------------------------------------------------------------
3bpxA           ----------------------------------------------------------------------
3broB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALKEEXXXXXXXXXXXXXYEAFMEVFRRAGFAP
1bi3A           PRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDH-------------------------------
1c0wA           ETDQFTQL--------------------------------------------------------------
1b9nA           ----------------------------------------------------------------------
1b9mB           ----------------------------------------------------------------------
1b9nB           EVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCE-----VLMALPDGQTLCATVPVNEATSL
1b9mA           ----------------------------------------------------------------------
1bi2A           TSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDR----------------------------
1bi1A           S-MPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDR----------------------------
1c0wC           ----------------------------------------------------------------------
3df8A           ----------------------------------------------------------------------
1a40A           APLSDEKLAQEPTVIGGVVLAVNIPGLKSGELVLDGKTL-------------------------------
3e6mF           ----------------------------------------------------------------------
1cy0A           ----------------------------------------------------------------------
3bj6B           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
3cjnA           ----------------------------------------------------------------------
3e6mB           ----------------------------------------------------------------------
1dtr-           ----------------------------------------------------------------------
1a54A           APLSDEKLAQFPTVIGGVVLAVNIPGLKSGELVLDGKTL-------------------------------
1ddnA           ----------------------------------------------------------------------
1bi3B           ----------------------------------------------------------------------
2bv6A           ----------------------------------------------------------------------
1cy8A           ----------------------------------------------------------------------
1c0wB           PRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGH----------------------------
1bi2B           ----------------------------------------------------------------------
3broC           ----------------------------------------------------------------------
3echA           ----------------------------------------------------------------------
3broA           ----------------------------------------------------------------------
1al3A           ALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQY--PLVTYTFGFTGRSELDTAFNRAGLTP
1dprA           ----------------------------------------------------------------------
1cy6A           ----------------------------------------------------------------------
3e6mE           ----------------------------------------------------------------------
3deuA           ----------------------------------------------------------------------
3bpxA           ----------------------------------------------------------------------
3broB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KVVREVARFSQAVSLVAAGLGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bi3A           ----------------------------------------------------------------------
1c0wA           ----------------------------------------------------------------------
1b9nA           ----------------------------------------------------------------------
1b9mB           ----------------------------------------------------------------------
1b9nB           QQGQNVTAYFNADSVIIATL--------------------------------------------------
1b9mA           ----------------------------------------------------------------------
1bi2A           ----------------------------------------------------------------------
1bi1A           ----------------------------------------------------------------------
1c0wC           ----------------------------------------------------------------------
3df8A           ----------------------------------------------------------------------
1a40A           ----------------------------------------------------------------------
3e6mF           ----------------------------------------------------------------------
1cy0A           ----------------------------------------------------------------------
3bj6B           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
3cjnA           ----------------------------------------------------------------------
3e6mB           ----------------------------------------------------------------------
1dtr-           ----------------------------------------------------------------------
1a54A           ----------------------------------------------------------------------
1ddnA           ----------------------------------------------------------------------
1bi3B           ----------------------------------------------------------------------
2bv6A           ----------------------------------------------------------------------
1cy8A           ----------------------------------------------------------------------
1c0wB           ----------------------------------------------------------------------
1bi2B           ----------------------------------------------------------------------
3broC           ----------------------------------------------------------------------
3echA           ----------------------------------------------------------------------
3broA           ----------------------------------------------------------------------
1al3A           RIVFTATDADVIKTYVRLGLGV------------------------------------------------
1dprA           ----------------------------------------------------------------------
1cy6A           ----------------------------------------------------------------------
3e6mE           ----------------------------------------------------------------------
3deuA           ----------------------------------------------------------------------
3bpxA           ----------------------------------------------------------------------
3broB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxx
1bi3A           -----
1c0wA           -----
1b9nA           -----
1b9mB           -----
1b9nB           -----
1b9mA           -----
1bi2A           -----
1bi1A           -----
1c0wC           -----
3df8A           -----
1a40A           -----
3e6mF           -----
1cy0A           -----
3bj6B           -----
1biaA           -----
3cjnA           -----
3e6mB           -----
1dtr-           -----
1a54A           -----
1ddnA           -----
1bi3B           -----
2bv6A           -----
1cy8A           -----
1c0wB           -----
1bi2B           -----
3broC           -----
3echA           -----
3broA           -----
1al3A           -----
1dprA           -----
1cy6A           -----
3e6mE           -----
3deuA           -----
3bpxA           -----
3broB           -----