[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS82166.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ba0B.bssp"
#ERROR : Can't open dsspfile "2ba0A.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "2ahoB.bssp"
#ERROR : Can't open dsspfile "3cw2C.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "3c19A.bssp"
#ERROR : Can't open dsspfile "2a1aA.bssp"
#ERROR : Can't open dsspfile "2ckzB.bssp"
#ERROR : Can't open dsspfile "2bh8B.bssp"
#ERROR : Can't open dsspfile "2a19A.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "2c35B.bssp"
#ERROR : Can't open dsspfile "2e3uA.bssp"
#ERROR : Can't open dsspfile "2ba1A.bssp"
#ERROR : Can't open dsspfile "2bh8A.bssp"
#ERROR : Can't open dsspfile "2ckzD.bssp"
#ERROR : Can't open dsspfile "2cqoA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1ah9A.bssp"
#ERROR : Can't open dsspfile "2asbA.bssp"
#ERROR : Can't open dsspfile "1e3pA.bssp"
#ERROR : Can't open dsspfile "2ba0B.bssp"
#ERROR : Can't open dsspfile "2ba0A.bssp"
#ERROR : Can't open dsspfile "3c19A.bssp"
#ERROR : Can't open dsspfile "3c19A.bssp"
#ERROR : Can't open dsspfile "2a1aA.bssp"
#ERROR : Can't open dsspfile "2ckzB.bssp"
#ERROR : Can't open dsspfile "2a19A.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "2c35B.bssp"
#ERROR : Can't open dsspfile "2e3uA.bssp"
#ERROR : Can't open dsspfile "2ba1A.bssp"
#ERROR : Can't open dsspfile "2bh8A.bssp"
#ERROR : Can't open dsspfile "2bh8A.bssp"
#ERROR : Can't open dsspfile "2ckzD.bssp"
#ERROR : Can't open dsspfile "2ckzD.bssp"
#ERROR : Can't open dsspfile "2cqoA.bssp"
#ERROR : Can't open dsspfile "1ah9A.bssp"
#ERROR : Can't open dsspfile "1ah9A.bssp"
#ERROR : Can't open dsspfile "1ah9A.bssp"
#ERROR : Can't open dsspfile "2asbA.bssp"

## Summary of PDB Search
:536
    6e-31  20%  2ba0B  [x.x.x] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4
    3e-30  19%  2ba0A  [x.x.x] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4
    8e-28  18%  3bzkA  [x.x.x] TEX
    5e-27  16%  2ahoB  [x.x.x] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
    1e-26  17%  3cw2C  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT ALPHA
    2e-26  17%  3bzcA  [x.x.x] TEX
    8e-26  15%  3c19A  [x.x.x] UNCHARACTERIZED PROTEIN MK0293
    4e-22  23%  2a1aA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA
    1e-18  11%  2ckzB  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 25 KD
    6e-17  26%  2bh8B  [x.x.x] 1B11
    8e-17  15%  2a19A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA
    5e-16  12%  1d7qA  [b.40.4] TRANSLATION INITIATION FACTOR 1A
    2e-15  10%  2c35B  [x.x.x] DNA-DIRECTED RNA POLYMERASE II 19 KDA
    3e-15  14%  2e3uA  [x.x.x] HYPOTHETICAL PROTEIN PH1566
    4e-15  20%  2ba1A  [x.x.x] ARCHAEAL EXOSOME RNA BINDING PROTEIN CSL4
    4e-15  22%  2bh8A  [x.x.x] 1B11
    3e-14  10%  2ckzD  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 25 KD
    2e-13  27%  2cqoA  [x.x.x] NUCLEOLAR PROTEIN OF 40 KDA
    4e-13  13%  2c0bL  [x.x.x] RIBONUCLEASE E
    5e-12  23%  1ah9A  [x.x.x] INITIATION FACTOR 1
    1e-11  18%  2asbA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    5e-09  27%  1e3pA  [d.14.1 - d.101.1 - a.4.9 - d.14.1 - d.101.1 - d.52.3 -
    9e-13  16%  2ba0B  [x.x.x] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4(query 27->197)
    4e-11  16%  2ba0A  [x.x.x] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4(query 14->193)
    1e-11   6%  3c19A  [x.x.x] UNCHARACTERIZED PROTEIN MK0293(query 112->268)
    2e-08  17%  3c19A  [x.x.x] UNCHARACTERIZED PROTEIN MK0293(query 25->95)
    3e-16  19%  2a1aA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA(query 110->281)
    2e-10  12%  2ckzB  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 25 KD(query 27->112)
    4e-07  16%  2a19A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA(query 27->182)
    2e-05  14%  1d7qA  [b.40.4] TRANSLATION INITIATION FACTOR 1A(query 102->200)
    7e-06  17%  2c35B  [x.x.x] DNA-DIRECTED RNA POLYMERASE II 19 KDA(query 82->190)
    1e-05  12%  2e3uA  [x.x.x] HYPOTHETICAL PROTEIN PH1566(query 90->207)
    5e-10  11%  2ba1A  [x.x.x] ARCHAEAL EXOSOME RNA BINDING PROTEIN CSL4(query 25->141)
    2e-14  27%  2bh8A  [x.x.x] 1B11(query 251->330)
    6e-04  16%  2bh8A  [x.x.x] 1B11(query 82->158)
    7e-13   7%  2ckzD  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 25 KD(query 149->294)
    1e-08  11%  2ckzD  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 25 KD(query 34->123)
    1e-05  20%  2cqoA  [x.x.x] NUCLEOLAR PROTEIN OF 40 KDA(query 114->200)
    3e-08  25%  1ah9A  [x.x.x] INITIATION FACTOR 1(query 381->440)
    1e-06  21%  1ah9A  [x.x.x] INITIATION FACTOR 1(query 231->277)
    2e-04  17%  1ah9A  [x.x.x] INITIATION FACTOR 1(query 33->104)
    2e-07  13%  2asbA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA(query 381->440)
:536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPL
2ba0B           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
3bzkA           AEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKLLD----TATVYPHAPKNQWDQ
2ahoB           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2a1aA           ----------------------------------------------------------------------
2ckzB           ----------------------------------------------------------------------
2bh8B           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
1e3pA           ----------------------------------------------------------------------
2ba0B           --------------------------RYTPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSEN-PEMK
2ba0A           -------------DQTETHVRVIPKGRYTPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENPEMK-
3c19A           ----------------------------------------------------------------------
3c19A           ------------------------FEDVRVVYGEREWRVSIAETEEGEVVTVKAEFDECREIGEETGIPP
2a1aA           ----------------------------------------------------------------------
2ckzB           --------------------------VFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGC
2a19A           --------------------------NKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGM--------I
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ------------------------SPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGEG
2bh8A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2ckzD           ---------------------------------EIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGC
2cqoA           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           --------------------------------NIEMQGTVLETLPNTMRVELENGHVVTAHISGKMRKN-
2asbA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKIEAQEKWDRIQELYEKGEPVTVTIKERVKGGVVAE
2ba0B           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
3bzkA           TLAVLAALC----------AKHQVELIAIGNGTASRETDKLAGELIKKYP-GMKLTKIMVSEAGASVYSA
2ahoB           -------------------------------------------------SEGEILIATVKQVFDYGSYVS
3cw2C           ------------------------------------------YSRSKLPSEGEILIATVKQVFDYGSYVS
3bzcA           -------------QTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKGMKLTKIMVSEAGASVYSA
3c19A           ----------------------------------------------------------------------
2a1aA           ----------------------------------------------------------------------
2ckzB           ----------------------------------------------------------------------
2bh8B           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
1e3pA           ----------------------------------------------------------------------
2ba0B           PNKKPNEVLDIGDAIIAKVLNIDPK-MKVTLTMKDRIGRIVAINPARVPRVIGKKGSMIKLLKSELDVQI
2ba0A           PNKKPNEVLDIGDAIIAKVLNIDPK-MKVTLTMKDRICRPIRFGRIVAINPARVPRVIIKLLKSELDVQI
3c19A           -----------------------------------------PSHLMFLVTVLDDRDGEVLGDAIQKLIER
3c19A           REAMVEAAARVGGWVDLKEREIKVQ---------------------------------------------
2a1aA           ---------------------------------------HCRFYENKYPEIDDIVMVNVQQIAEMGAYVK
2ckzB           YYTPEESYFDVNEKIRFRIEREVFVDVKPPAYALLGSCQTDG----------------------------
2a19A           LLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVS-SEDIIKCEEKYQKSKTVHSILRYCAEKFQIPL
1d7qA           -------------------------------NRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEA
2c35B           -----------GFVIAVTTIDNI-GAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTE
2e3uA           -------------------ITIDSETGEVWITSTKTEDPLAVWKARDIVLARGFSPERAFRLLNEGEYLE
2ba1A           YVKEISEAVGYLDILKARVIGDNLRLSTKEEEMG------VLRALCSNCKTEMVREGDILKCPECGRVEK
2bh8A           ----------------------------------------------------------------------
2bh8A           -----------NADKGFGFITPDDGSKDVFVHFSAGS---SGAAVRGNPQQGDRVEGKIKSITDFGIFIG
2ckzD           ----------------------------------------------------------------------
2ckzD           YYTPEESAWIVNEKIRFRIEREVFVDVPPAYALLGSC-QTDGMGLVSWWEHHH-----------------
2cqoA           -------------------------------------------RPETMEALYTIFQGEVAMVTDYGAFIK
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           -----YIRILTGDKVTVELTPYDLSKGRIVFRSR------------------------------------
2asbA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDGIQGFMPASQLDLRRVPNLDEFVGQQVLAKIIEFHRRKGRVILSRRAVLEEEQKKAREAFLKSLEPGQ
2ba0B           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
3bzkA           SELAAKEFPELDVSLR--GAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQLKLARSLDAVVEDCV--
2ahoB           LDGLQAFLPWSEVNIRDVLK----ENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDK
3cw2C           LDGLQAFLPWSEVSSKWVKNIRDVENRKVIVKVIRVDRRKGTVDVSLKKVTDDER-------RKKNLQWK
3bzcA           SELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQLKLARSLDAVVEDCVNAV-
3c19A           ----------------------------------------------------------------------
2a1aA           ----------------------------------------------------------------------
2ckzB           ----------------------------------------------------------------------
2bh8B           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
1e3pA           ----------------------------------------------------------------------
2ba0B           VVGQNGLIWVNGDRRKVSIAEEAIIEQEAHTEGL-----TDRVAEFIKRRKADVGIQ-------------
2ba0A           VVGQNGLIWVNGDRRKVSIAEEAIIEQEAHTEGL-----TDRVAEFIKRRKAD-----------------
3c19A           EEVLACHAVPCVTKKNRPGHVLVVLGGEDPDRVAEDVIMVLTGSTGVDRFDADVYSVPSRFEDVRVVYGE
3c19A           ----------------------------------------------------------------------
2a1aA           LLNIEGMILLSLIR----------VGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHS
2ckzB           ----------------------------------------------------------------------
2a19A           EELYKTIAWPLSRKLSIIDETVWEGIEPPSKDVLDELKNYIS----------------------------
1d7qA           MDGVKRLCHIRGKLRKKV---WINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGE----------
2c35B           IGPMSCFISRHSIPSEMEFDPNSNPDDEIRLKIVGTRVDKNDIFAIGSLM--------------------
2e3uA           IINLTDIIALPRVRGRIIKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEI-----AKTAIEKLAR---
2ba1A           R---------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2bh8A           LDGIDGLVHLSDISWAQA----------------------------------------------------
2ckzD           --------PPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQYINVTFRAVVFKPFLGE
2ckzD           ----------------------------------------------------------------------
2cqoA           IPRKQGLVHRTHMSSCRVDKPSEIVGDKVWVKLIGRKNDRIKVSLSMKVVNQGTGKDLDP----------
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXNLGPVDGLVHRSEITWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKALI
2ba0B           -----------------------VLPGDLLSTNPRAAGYGTYVEGGKVYAKIIGLFDQTETHVRVI----
2ba0A           -----------------------VLPGDLLSTNPRAAGYGTYVEGGKVYAKIIGLFDQT-------ETHV
3bzkA           ----------------NAVGVDVNTASAALGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQA
2ahoB           --------------------ILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITA--IEKAVKEGEKILID
3cw2C           KIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEI---------
3bzcA           ------------GVDVNTASAALLARISGLNSTL--AQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQA
3c19A           ---------------------------------------------------------------------L
2a1aA           ----------------------------------------------------------------------
2ckzB           --------------------FHRDTISAITHQLNNKFANKIIPNGLCITIYDLLTVEEGQLKPGDGSSYI
2bh8B           ---------------------------SGKMTGI------VKWFNADKGFGFITPDDGSKDVFVHFSAGS
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ------------------------LLNTVKQKLFTEVEGTCTGKGFVIAVTTIDNIGAGVIQPGRGFVLY
2e3uA           --------------------------------------AVLIGKKGQTKKEIITIDSETGEVWITSTKET
2ba1A           ----------------------------------------VYEEGGELFAAVAGKLIIKDRVAKVESISP
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2c0bL           -------------------------------------------EGRHMKRMLINATQQEELRVALVDGQR
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
1e3pA           ---------------------------------------------------------------------Q
2ba0B           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
3c19A           WRVSVKIAETEEGEVVTVKAFDECREIGEETGIPPREVKAAARVGGWVDLKEREIKVQ------------
3c19A           ----------------------------------------------------------------------
2a1aA           ILRYCAEKF-------QIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYI
2ckzB           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------VKWFNADKGFGFITPDDGSKDVFVHFSAGS
2bh8A           ----------------------------------------------------------------------
2ckzD           IVTGWISKCTAEGIKVSLLGFDDIFIPQNMLFEGCYYTKLYFDVNEKIRFRIEREVFVDVPPAYALLGSC
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           --------------------HVVTAHISGKMR----KNYIRILTGDKVTVELTPYDLSKGRIVFRSR---
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PDPWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVL
2ba0B           ---PLKGRYTPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENPEMKPNKKPNEVLDIGDAIIAKVL
2ba0A           RVIPLKGRYTPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENPEMKPNKKPNEVLDIGDAIIAKVL
3bzkA           AGFLRVMNGDNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILK
2ahoB           AGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVIS-KALENIEQDY--ESLLNIKIY
3cw2C           ---WVKPLLEEASKHAEERKVKMSGLITVRTNEP---LGVEKIKEVIS-KALENIEQDYESLLNIKIYTI
3bzcA           AGFLRVMNGDNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILK
3c19A           DYEPSHLMFLVTVLDDRDGEVLGDAIQKLIEREE-VLACHAVPCVTKK-NRPGHVLVVLVDGGEDPDRDV
2a1aA           ------------IDDIVMVNVQQIAEMGAYVKLLDNIEGMILLSLIRV-------------GKNDVAVVL
2ckzB           NVTFRAVVFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEIWPMDTKLYFDVNEKIRFRIE
2bh8B           SGAAVRGNPQ--QGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWAQ--------------------
2a19A           --------KYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILL-------SSIQKLIRVGKNDVAVVL
1d7qA           ---------VFKEDGQEYAQVIKMLGNGRLAMCFDGVKRLCHIRGKLRKK------VWINTSDIILVGLR
2c35B           PVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEI-GPMSCFISRHSIPS-EMEFDPNSNPPCYDEIRLKIV
2e3uA           EDPLAVWKARDIVRGFSPERAFRLLNEGEYLEI-INLTDIIALPRVR-GRIIGRKGRTRQIIEEMSGASV
2ba1A           -------IPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGGYVKEISEAVGYLDILKARVI
2bh8A           ---------------------------------------------------------VKWFNADKGFGFI
2ckzD           ----------------VTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEPMDEETKLYFDVNEKIRFRIE
2cqoA           ------------LYTIFQGEVAMVTDYGAFIKIPGRKQGLVHRTHMSS-CRVDKPSEIVDVGDKVWVKLI
2c0bL           LYDLDIESPEQKKANIYKGKITRI--EAAFVDYGAERHGFLPLKEIAEYFPRPNIKDVLREGQEVIVQID
1ah9A           -------------NIEMQGTVLETLPNTMFVELENGHVVTAHISGKMR-----KNYIRILTGDKVTVELT
2asbA           ------------EGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGESYEHGNRLRCYVV
1e3pA           EDTGAEIYIGAADGPAAEAGSVVKTTFGAFVSL---LDGLLHLG----------------VGQKVQVEIA
2ba0B           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2a1aA           S---------------------------------------------------------------------
2ckzB           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           SGAA--VRGNPQQGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWAQ--------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           QTDGMGLVSWWEHH--------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RLDPEERRLSLGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN
2ba0B           NID-PKMKVTLTMKDRICRPIRFGRIVAINPARKKGSMIKLLKSELDVQIVVGQNGLIWVNGDRRKVSIA
2ba0A           N-IDPKMKVTLTMKDRIGRIVAINPARVPRVIGKKGSMIKLLKSELDVQIVVGQNGLIWVNGDRRKVSIA
3bzkA           ELDKPGRDPRPEFKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKD
2ahoB           TIGAPRYRVDVVGTNPKEASE----ALNQIISNLIKIGKEENVDISVV----------------------
3cw2C           GAPRYRVDVVGTNPKEASEALNQIISNL------IKIGKEENVDISVVK---------------------
3bzcA           ELDKPGRDPRPEFKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKD
3c19A           ARDIMVLTGSTGVDRFDADGVYSVDVRVVYGEREWRVSVKITEEGEVVTVKAEFDECREIGEETGIPPRE
2a1aA           RVDKEKGYIDLSKRRVSSEDIIKCEEKYQKS----KTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGH
2ckzB           REVFVDVKPPAYALLGGLVSWWE-----------------------------------------------
2bh8B           ----------------------------------------------------------------------
2a19A           RVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKF-QIPLEELYKTIAWPLSRKFGHAYI
1d7qA           DYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------------------
2c35B           GTRVDKNDIFAIGSLMDDYL--------------------------------------------------
2e3uA           SVYGKTVAIIGNPIQIEKTAIEKLARGSPHGSVYRYLE--------------------------------
2ba1A           GDNLRLSTKEEEMG-----VLRALCSNCKTEMVREGDILKCPECGRVEKRK-------------------
2bh8A           TPDDGSKDVFVHFSAGSSGAAV--RGNPQQGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWAQAE-
2ckzD           REVFVDVPPAYALLGSCQTDGMGLVSWWE-----------------------------------------
2cqoA           GREMKNDRVSLSMKVVNQGTGKDLDPNNVIIES-------------------------------------
2c0bL           KEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRIELKEALA-------------------------
1ah9A           PYDLSKGRIVFRSR--------------------------------------------------------
2asbA           GVTRGAREPLITLSRTHPNLVRKLFSLEV-----------------------------------------
1e3pA           EIDSRGK---------------------------------------------------------------
2ba0B           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2a1aA           ----------------------------------------------------------------------
2ckzB           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
1ah9A           ------------------------------NIEMQGTVLETLPNTMFVELENGHVVTAHISGKMRKNYIR
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           ------------------------------GEIVAGVIQRDSRANARGLVVVRIGTETKASEVIPAAEQV


                         .         .         +         .         .         .         .:490
query           PAALFKKGDEMEVVVLNIDPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ba0B           EEAIYLIEQEAHTEGLT-----------------------------------------------------
2ba0A           EEAIYLIEQEAHTEGL------------------------------------------------------
3bzkA           PYEVVKAGDIVKVKVMEVDI--------------------------------------------------
2ahoB           ----------------------------------------------------------------------
3cw2C           ----------------------------------------------------------------------
3bzcA           PYEVVKAGDIVKVKVMEVDI--------------------------------------------------
3c19A           VKAAARVGGWVDLKEREIKV--------------------------------------------------
2a1aA           AYEAFKLSIIDETVWEGIEP--------------------------------------------------
2ckzB           ----------------------------------------------------------------------
2bh8B           ----------------------------------------------------------------------
2a19A           DETVWEGIEPPSKDVLDELK--------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
1e3pA           ----------------------------------------------------------------------
2ba0B           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
3c19A           ----------------------------------------------------------------------
2a1aA           ----------------------------------------------------------------------
2ckzB           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
2e3uA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2bh8A           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
1ah9A           ----ILTGDKVTVELTPYDL--------------------------------------------------
1ah9A           ----------------------------------------------------------------------
1ah9A           ----------------------------------------------------------------------
2asbA           PGESYEHGNRLRCYVVGVTR--------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ba0B           ----------------------------------------------
2ba0A           ----------------------------------------------
3bzkA           ----------------------------------------------
2ahoB           ----------------------------------------------
3cw2C           ----------------------------------------------
3bzcA           ----------------------------------------------
3c19A           ----------------------------------------------
2a1aA           ----------------------------------------------
2ckzB           ----------------------------------------------
2bh8B           ----------------------------------------------
2a19A           ----------------------------------------------
1d7qA           ----------------------------------------------
2c35B           ----------------------------------------------
2e3uA           ----------------------------------------------
2ba1A           ----------------------------------------------
2bh8A           ----------------------------------------------
2ckzD           ----------------------------------------------
2cqoA           ----------------------------------------------
2c0bL           ----------------------------------------------
1ah9A           ----------------------------------------------
2asbA           ----------------------------------------------
1e3pA           ----------------------------------------------
2ba0B           ----------------------------------------------
2ba0A           ----------------------------------------------
3c19A           ----------------------------------------------
3c19A           ----------------------------------------------
2a1aA           ----------------------------------------------
2ckzB           ----------------------------------------------
2a19A           ----------------------------------------------
1d7qA           ----------------------------------------------
2c35B           ----------------------------------------------
2e3uA           ----------------------------------------------
2ba1A           ----------------------------------------------
2bh8A           ----------------------------------------------
2bh8A           ----------------------------------------------
2ckzD           ----------------------------------------------
2ckzD           ----------------------------------------------
2cqoA           ----------------------------------------------
1ah9A           ----------------------------------------------
1ah9A           ----------------------------------------------
1ah9A           ----------------------------------------------
2asbA           ----------------------------------------------