[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS82289.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3biiD.bssp"
#ERROR : Can't open dsspfile "3dwgC.bssp"
#ERROR : Can't open dsspfile "3cwiA.bssp"
#ERROR : Can't open dsspfile "2ekiA.bssp"
#ERROR : Can't open dsspfile "3dwmA.bssp"

## Summary of PDB Search
:223
    3e-15  37%  3biiD  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 1
    2e-13  25%  3dwgC  [x.x.x] 9.5 KDA CULTURE FILTRATE ANTIGEN CFP10A
    4e-09  25%  3cwiA  [x.x.x] THIAMINE-BIOSYNTHESIS PROTEIN THIS
    4e-07  17%  2ekiA  [x.x.x] DEVELOPMENTALLY-REGULATED GTP-BINDING PROTEIN 1
    7e-04  21%  3dwmA  [x.x.x] 9.5 KDA CULTURE FILTRATE ANTIGEN CFP10A
:223

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEV
3biiD           --IKVLFFAQVRELVGTDATEVAADFP-TVEALRQHMAAQSDRWADGKLLAAVNQTLVSFDHPLTDGDEV
3dwgC           --VTVSIPTILRPHTGGQKS--VSASGDTLGAVISDLEANYSGISHRFVNIYVNDESGGLATAIADGDSV
3cwiA           -----------------KPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAV
2ekiA           ---LVRIYTKPKGQLPDTSPVVLPYSRTTVEDFHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVI
3dwmA           --VTVSIPTILRPHTGGQKS--VSASGDTLGAVISDLEANYSGISEIYVNDEDVRFSGGLATAIADGDSV


                         .         .         *         .         .         .         .:140
query           AFLPPVSGGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3biiD           AFFPPVTG--------------------------------------------------------------
3dwgC           TILPAVAGG-------------------------------------------------------------
3cwiA           EFLYFGGG--------------------------------------------------------------
2ekiA           QIV-------------------------------------------------------------------
3dwmA           TILPAV----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3biiD           ----------------------------------------------------------------------
3dwgC           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------
2ekiA           ----------------------------------------------------------------------
3dwmA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxx
3biiD           -------------
3dwgC           -------------
3cwiA           -------------
2ekiA           -------------
3dwmA           -------------