[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80359.1

[Show Plain Result]


## Summary of Sequence Search
    1::417
    1::282     3e-22  37%  282 aa  PF01547 SBP_bac_1 "Bacterial extracellular solute-binding protein"
    1::417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGGAPKAALENLVVEFNKAQQGRCVRPV
PF01547         -------------------------------------------GDGGDAAAQELVKAFEK-NPGIKVKYV


                         .         .         *         .         .         .         .:140
query           PQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYG
PF01547         YVGS-GDLLQKLKTALAAGDGPDVVVLDPDWLAELAKAGLLAPLDDLDLDKDALSSDFLPGILDTGKLYG


                         +         .         .         .         .         *         .:210
query           VPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKD
PF01547         LPYDGTTG-LYYNKDLFKKAGLDPPKTWDDLLDAAKKLKAKGPDPGAYGGDGSGTAGYFLLALAGLFDED


                         .         .         .         +         .         .         .:280
query           GKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLP
PF01547         G---FNSPEAVEALEYLKKLYKKGLAPP---GVLTKDFASGEAAMGISGSWAAVALVEKPKFDVGVAPLP


                         .         *         .         .         .         .         +:350
query           GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAxxxxxxxxxxxxxxxxxxxxxxxxx
PF01547         GGSVGGDGLAIPKG---------SKNKEA-AKKFLDFLLSPEGAA-------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01547         -------------------------------------------------------------------