[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80360.1

[Show Plain Result]


## Summary of Sequence Search
    1::620
    8::381     1e-53  39%  381 aa  PF01314 AFOR_C "Aldehyde ferredoxin oxidoreductase, domains 2 & 3"
    1::200     1e-42  47%  203 aa  PF02730 AFOR_N "Aldehyde ferredoxin oxidoreductase, N-terminal
    1::620

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxYHDRVAFVDLSTGKVWYESFGEAFWXXXXXXXXXXXXXXXXHVPKGADPLGPENALVFAPGILTGT
PF01314         ----------------------------------------------------------------------
PF02730         ----YAGKILRVDLSTGKIEVEELPEELARKFLGGRGLGAKLLWDEVPPGVDPLSPENKLVFATGPLTGT


                         .         .         *         .         .         .         .:140
query           PISGSGRNTVAAKSPLTXXXXXXXXXXXXXXXLKNAGLDALVVLGQAEAPVYLHVEGGKVALHPAVHLWG
PF01314         ----------------------------------------------------------------------
PF02730         PAPGSGRLIVVFKSPLTGGIGESNMGGAFGPELKFAGYDAIVIEGKAEKPVYLVINDDKVEIRDASHLWG


                         +         .         .         .         .         *         .:210
query           KDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDLAHFAGRGGLGAVMGAKRLKAVSARxxxxxx
PF01314         ----------------------------------------------------------------------
PF02730         KGTYETTEYLKEEFGDKARVAAIGPAGENLVRGASISNDLGRAAGRGGLGAVMGSKNLKAIVVR------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxARRMAKERMDRAAGLVTMGTVGTVKPFNLRGVLPSHNFLDGFSEGAEALDGTSLDALG
PF01314         ------------AAKVVKSHPVTGSGLPKYGTAGLVNWLNETGALPTRNFQEGYFEKAEKISGEAIEKYL
PF02730         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRIGRDTCYACAIRCKQVVKIEGTGKYDVRXXXXXXXXXXXXXXXSTCGVTDPYAVTKANTLCNQYGLDV
PF01314         VRMGG--CHGCPIRCKKVVRVKGYTE--------GPEYETIWALGPNLGIDDLEAILKLNDLCDDLGLDT
PF02730         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IGVGVTIACAMEAVEKGYLDDEGLGLRFGNGDALIAAIXXXXXXXXXXXXXXXXXXKRLAESLGHPELAM
PF01314         ISTGGTIAWAMELYEKGLLKPEGLELEFGDAEAALE-LLERIAKREGIGDILAEGVRRAAEKLGGEEYAM
PF02730         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPLPIEDLSEAKI
PF01314         HVKGLELPAYDPRGAKGMGLGYATSNRGADH---------------LRGYTIAPEILGPEAYDPLKEGKA
PF02730         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVGERTLQLTRLFNLREGISPEE
PF01314         ELVKWFQDLTALIDSLGLCKFVWFMAELYAKLLNAVTGIDLTPEELLEAGERIYNLERAFNVREGFTRED
PF02730         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEGGVDPERLRALGLxxxxxxxx
PF01314         DTLPERFFEEPLPEGPAKRLDREDLEEMLDEYYKLRGWDETGVPTRLEELGL--------
PF02730         ------------------------------------------------------------