[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80391.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
   23::333     1e-27  37%  341 aa  PF00155 Aminotran_1_2 "Aminotransferase class I and II"
   41::175     8e-05  31%  359 aa  PF00266 Aminotran_5 "Aminotransferase class-V"
  165::216     5e-04  45%  218 aa  PF07082 DUF1350 "Protein of unknown function (DUF1350)"
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLQY
PF00155         -------------------------------------------------------------------LGY
PF00266         ----------------------------------------------------------------------
PF07082         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
PF00155         GPPQGLPELREAIADFLGRRPEEILVTSGAQAALALLLQLLLDPGDEVLVPEPTYPSYIAAARLAGAEVV
PF00266         --TELVEEAREKLARLLGADPDEVVFTSGGTEALNLVARGLLKPGDEILVSATEHHSNLLPWRRLGAEVT
PF07082         ------------------------------------------------------------------PRNL


                         +         .         .         .         .         *         .:210
query           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
PF00155         PVPLDEDGLDLEALEAALTEAKTK-LIVLPNPNNPTGAVLSLEELEELAELARKYDLLIIEDEAYGELVY
PF00266         VIPVDEDGVDLEDLEAALTPDTA--LVSLTHVSNETGVIQPI---AEIAALAHEHGALVVVDAA------
PF07082         LIKFNDDAIDTDILEQVLK---PRFEDLVSKVTLPGNHLTPLSQRRLLLQ--------------------


                         .         .         .         +         .         .         .:280
query           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
PF00155         GGEDFVS--ALASLDGDPNVIVLGSFSKAFGPGLRLGYIVAPPELIEALRKLARPLTSPSTPLQAAAAAA
PF00266         ----------------------------------------------------------------------
PF07082         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
PF00155         LSDGGLLDRHLEELRARLRERRDLLREALEELGLEV--IPPEGGFFLWLDLPE-LDAEELAQALLEEGVL
PF00266         ----------------------------------------------------------------------
PF07082         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FVPGGPFFANGGGENTLRLSYATLDRExxxxxxxxxxxxxxxxxxxx
PF00155         VVPGSGFGVPGPG--YLRISFALTEEE--------------------
PF00266         -----------------------------------------------
PF07082         -----------------------------------------------