[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80551.1

[Show Plain Result]


## Summary of Sequence Search
    1::136
    1::97      1e-08  36%  101 aa  PF00011 HSP20 "Hsp20/alpha crystallin family"
    1::136

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDLLETEEHYVLLVDLPGVRPEDLELLEEGQ
PF00011         ----------------------------------------DVKETDDAYVITADLPGFKKEDIKVEVEDN


                         .         .         *         .         .         .         .:140
query           RVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPATALPLKxx
PF00011         RLTISGEREEEEDKYHRSERSYGEFSRRFRLPENVDADKIKASLENGVLTVTVPKKEPEEKPRK--