[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80636.1

[Show Plain Result]


## Summary of Sequence Search
    1::443
   14::180     3e-22  41%  186 aa  PF03721 UDPG_MGDP_dh_N "UDP-glucose/GDP-mannose dehydrogenase
    1::95      3e-20  49%   96 aa  PF00984 UDPG_MGDP_dh "UDP-glucose/GDP-mannose dehydrogenase family,
    2::103     8e-07  39%  104 aa  PF03720 UDPG_MGDP_dh_C "UDP-glucose/GDP-mannose dehydrogenase
   19::183     9e-05  29%  255 aa  PF02153 PDH "Prephenate dehydrogenase"
    3::99      3e-04  30%  160 aa  PF03446 NAD_binding_2 "NAD binding domain of 6-phosphogluconate
    1::443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFAVEKAKVGFRVIGVEQNPRRAELVNRGESYIADVPT
PF03721         --------------------------------PTAACFAEKGHEVIGVDIDEEKVEALNSGESPIYEPGL
PF00984         ----------------------------------------------------------------------
PF03720         ----------------------------------------------------------------------
PF02153         ----------------------------------------------------------------------
PF03446         ---------------------------------------KIGFIGLGVMGSPMALNLLKAGHTVVYDRTP


                         .         .         *         .         .         .         .:140
query           EVLKEVVDKGLLRAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTY
PF03721         ELLKENVAAGRLRFTTDLEEIADADVVFIAVPTPTDEDGSPDLSYVEAAARTIAKVLKKGAIVVIKSTVP
PF00984         ----------------------------------------------------------------------
PF03720         ----------------------------------------------------------------------
PF02153         ESLEAALELGVIEAATDLEALADADLVILAVPVAAT----------EAVLAELAPHLKPGAIVTVGSVKA
PF03446         EKVEALVAEGAVAAASPAEAVASADVVITMVPAGAA---------VDAVLFGLLPGLEKGDIIIDGSTIS


                         +         .         .         .         .         *         .:210
query           PGTTEEVMLPILEQSGLKVEEDFFLVHSPERVDPGNKRYTTRNTTKVVGGVGPRSLEAGVFFYSQTIEKV
PF03721         VGTTEEVVKPILEELSGLGGVDFFVASNPEFLREGDAVYDLLNPDRVVIGSTPERAE-------------
PF00984         ----------------------------------------------------------------------
PF03720         ----------------------------------------------------------------------
PF02153         PVAAAEALLPEPEKSGVEAADADLFEGAPVVLTPGR-------------GTDPEAVERVLELWRALGARV
PF03446         PADT------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VPVSSAKAAELVKVFENTFRAVNIALVNELAMLCDRMGLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIP
PF03721         ----------------------------------------------------------------------
PF00984         -----ARTAELIKLAENAFLAVNIAFANELANLCEALGIDVWEVIEAAGTDPIGNHFLNPGPGVGGHCLP
PF03720         ----------------------------------------------------------------------
PF02153         VEMSAEEHDRVVALVSHLPHLLAFALVNALALL-------------------------------------
PF03446         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IDPHYLEWKAKEYNFNTHFIALAGEINRKxxxxxxxxxxxxxxxxxxxxxxxxxxVLGVAYKRDIPDYRE
PF03721         ----------------------------------------------------------------------
PF00984         KDPKALVAKAQELGVPPRLLEAVINVNER-----------------------------------------
PF03720         -------------------------------------------------------VLGLAFKPNTDDTRE
PF02153         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SPAIEVIRGLRRLGAEVEYHDPHVPRFAEGGLAMESVPLSEERVREKDLVLIATDHSAFDYKAIVAQARR
PF03721         ----------------------------------------------------------------------
PF00984         ----------------------------------------------------------------------
PF03720         SPALDIIEKLLEEGAEVRIYDPKVKEREELLPGINVVSSLEEAIKGADAIVILTEWDEFDYEAFIFDGRN
PF02153         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VLDxxxxxxxxxxxxxxxxxxxx
PF03721         -----------------------
PF00984         -----------------------
PF03720         ILD--------------------
PF02153         -----------------------
PF03446         -----------------------