[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80675.1

[Show Plain Result]


## Summary of Sequence Search
    1::369
   41::144     3e-08  38%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::369

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLLL
PF00528         ------------------------------------------------------------------LLLL


                         .         .         .         +         .         .         .:280
query           WAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFR
PF00528         FAIGLGGGWILGLLGLGHG----LLAVILALVLSTAPFVRLIRRAALESIPKDLIEAARALGASRWQTFR


                         .         *         .         .         .         .         +:350
query           RVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         RVILPLALPGIITGLILAFIGALGEFVIAELLGG------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxx
PF00528         -------------------