[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80708.1

[Show Plain Result]


## Summary of Sequence Search
    1::421
   20::153     3e-10  38%  170 aa  PF00587 tRNA-synt_2b "tRNA synthetase class II core domain (G, H,
    4::88      4e-05  37%   91 aa  PF03129 HGTP_anticodon "Anticodon binding domain"
    1::421

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
PF00587         -------------------------------------EIDTPILEPYELLK--ASGHVDKFADEMYKFKD
PF03129         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
PF00587         RGGRDLYLRPETTQPIARNFKNLLLSYRKLPLRLAQIGKVFRNERPRRGRVREFTQVEAEIFGTPEQSNE
PF03129         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AEAVVLLYECLKELGLRRLKVKLSSVGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00587         AEMIALAEEFLEKLGLDPYRVRLHTRGE------------------------------------------
PF03129         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLIPLTEEAVAEAFYLAEA
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------VIPLGDELLDYAQELAAE


                         .         .         .         .         *         .         .:420
query           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLxxxx
PF00587         ----------------------------------------------------------------------
PF03129         LRAAIRVELDDSSGSLGKKIKRADLRGIPYAIIVGEKELEDGTVTVKDRDTGEQETVPLDELVEYL----


                         .         .         +         .         .         .         .:490
query           x
PF00587         -
PF03129         -