[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80739.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
   39::313     3e-16  29%  313 aa  PF01032 FecCD "FecCD transport family"
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVTELRLPRXXXXXXXX
PF01032         -----------------------------------------------------IVWELRLPRILAALLVG


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQHAVFQHLPLSATFFGFXXXX
PF01032         AALAVAGALMQGLTRNPLADPGILGVSSGAALGAVLAILLFPGLS--------LLGLPLAA-FIGALLAA


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXYLMMQDADRVRAVFAYTLGNLAFAGWEGVRVXXXX
PF01032         LLVYLLARRRGGLSPLRLLLAGIAVSALFSALTSLLLLLADPEQLQSLLFWLMGSLAGATWSDVLILLPV


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXGRVLNALGLGEETARXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIIGFVGLVTPHLLRR
PF01032         LLIGLILALLLARRLNVLSLGDDVARSLGVNVERLRLLLLLLAALLTAAAVAVVGPIGFVGLVVPHIARL


                         .         *         .         .         .         .         +:350
query           LLGEDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELPVGVVTTLLGGPFFLYLMWRxxxxx
PF01032         LVGPDHRRLLPASALLGALLLLLADLLARTLLAPAELPVGIVTALIGAPFFLYLLRR-----