[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80786.1

[Show Plain Result]


## Summary of Sequence Search
    1::177
    1::160     2e-33  53%  160 aa  PF04079 DUF387 "Putative transcriptional regulators (Ypuh-like)"
    1::177

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERVAGGWRLVVHP
PF04079         --------SIIEALLFVAGEPLSLEELEVLGLEVDEVREALEELQAEYADRGRGLELVEVAGGWRLQTRP


                         .         .         *         .         .         .         .:140
query           KALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGVLESLLERGLVRVVGEKEAPG
PF04079         EFADYVERLVEGKPPRLSQAALETLAIIAYRQPVTRAEIEEIRGVNSDGVIRTLLERGLIEEVGRKEVPG


                         +         .         .         .         .         *         .:210
query           RPKLYGTTERFLEVFGLESLEDLPPLxxxxxxxxxxx
PF04079         RPILYGTTEEFLDYFGLKSLDELPPL-----------