[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80787.1

[Show Plain Result]


## Summary of Sequence Search
    1::195
    1::178     8e-22  46%  178 aa  PF01300 Sua5_yciO_yrdC "yrdC domain"
    1::195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALEL
PF01300         -------------DALRAGGVVAFPTETVYGLGCDATNEEAVERLRAAKGRPSDKPLIVMVASLEQLRRY


                         .         .         *         .         .         .         .:140
query           VDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHALLRELLRRVGGHAAATSLNKS
PF01300         AREVPEEA--LRLIERFWPGPLTLILPAESLPPLVTPGDTVGVRVPDHPLARALLRALGEPLVATSANLS


                         +         .         .         .         .         *         .:210
query           GEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVLREGxxxxxxxxxxxx
PF01300         GEPSPTTAEEVLEGIVDLILDGGGVGVPSTVVDLTGGPILRRG------------