[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80819.1

[Show Plain Result]


## Summary of Sequence Search
    1::211
    4::178     7e-13  39%  178 aa  PF01323 DSBA "DSBA-like thioredoxin domain"
    1::211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDFSNYLCPHCQNHALNVLPR
PF01323         --------------------------------------------------EFFDFVCPWCYIGE----PR


                         .         .         *         .         .         .         .:140
query           LKAEYIDTGKVRYLFRDFPFPGQANVIRXXXXXXXXXXQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVD
PF01323         LEAEYPDVGRAQYLLADFNFPGPGNTLDAHRAALAAAEQGKQLEVFEALFRAIFEEGRDISDP--EVLAE


                         +         .         .         .         .         *         .:210
query           LAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALxxx
PF01323         IAAEAGLDAEEFDAALNSDAVKAAVRADTQLARALGVTGVPTFVVNGKLVSGAQPLE----VLEEAL---


                         .         .         .         +         .         .         .:280
query           x
PF01323         -