[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80853.1

[Show Plain Result]


## Summary of Sequence Search
    1::274
  109::262     1e-17  42%  262 aa  PF01148 CTP_transf_1 "Cytidylyltransferase family"
    1::274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01148         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLMAFLYLPWSLGYVLLLRETPDAAMG
PF01148         --------------------------------------------LLGLIYVVWFLQSLLLIA---NIYFG


                         +         .         .         .         .         *         .:210
query           LWTLTLPLVASFATDIGAYFIGRAFGRRKLAPEISPGKTVEGSLGGIAVSFLALVVYTGLVREVFPFXXX
PF01148         LIWLLLLILLVWAGDTGAYFVGRLFGKHKLAPKISPKKTWEGFIGGLVAAVLVALLFA-LLLPPFLLSPW


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXXXAESMLKRFAGVKDSGNFLPGHGGLLDRIDSLLFAFPLTYFLVVLxx
PF01148         HLLLLGLLASLVGVFGDLFESMFKRDAGIKDSGNLIPGHGGILDRFDSLLLAAPFFYLYLLL--