[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80854.1

[Show Plain Result]


## Summary of Sequence Search
    1::185
    2::165     5e-38  52%  165 aa  PF01765 RRF "Ribosome recycling factor"
    1::185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQS
PF01765         --------------------LKRELAKIRTGRANPSLLDGIRVEYYGSPTPLNQLAQVSVPDARTLSITP


                         .         .         *         .         .         .         .:140
query           WDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRRXXXXXX
PF01765         FDKSLVKAIEKAIRASDLGLNPQNDGTVIRVPIPPLTEERRKELVKVAKKEAEEAKVAVRNIRRDANDKL


                         +         .         .         .         .         *         .:210
query           XXXXXXXHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEILx
PF01765         KKLEKDKEISEDDVKRLEKEVQKLTDKYIKKIDELLKAKEKELM-