[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80903.1

[Show Plain Result]


## Summary of Sequence Search
    1::370
   30::245     1e-12  30%  276 aa  PF01875 Memo "Memo-like protein"
    1::370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01875         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPGEGEEARVL
PF01875         ------------------------------------------------------------PGPGG-ARAI


                         +         .         .         .         .         *         .:210
query           LMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGXXXXXXXXXXXXXX
PF01875         IAPHAGYSYSGPVAAHAYKALDLSKA-KRVFILGPSHHGYLSGCALSPASWETPLGDLPVDTELIEELLK


                         .         .         .         +         .         .         .:280
query           XXXFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSH
PF01875         TGPFFTIDD-LAHEDEHSIEVQLPFLQYLLGDDKIVPILVGSTSPEFGEALAPYLADPENLFVISSDFCH


                         .         *         .         .         .         .         +:350
query           VGPRFGDTPLTRTLAEEARRRDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRExxxxxxx
PF01875         WGSRFGYDSSPGEIAESIEALDKAAMEAIEALDPEGFYDYLKKTGNTICGRHPIGVLLAAAKE-------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxx
PF01875         --------------------