[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80912.1

[Show Plain Result]


## Summary of Sequence Search
    1::427
    4::316     1e-35  42%  336 aa  PF00202 Aminotran_3 "Aminotransferase class-III"
    1::427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGEGAYVWDADGNRYLDYVMSWGPLILG
PF00202         ------------------------------------------RAEGAYLWDVDGNRYLDFLSGWGVVNLG


                         .         .         *         .         .         .         .:140
query           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTNRPYI
PF00202         HNHPEVVEAIAEQAARHVSFGFTHEPAVELAEKLELTPPGLDKVFFANSGSEAVEAALKLARGYTGRTKI


                         +         .         .         .         .         *         .:210
query           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPXXXXXXXXXXXXXIAAIIFEP
PF00202         IAFEGSYHGRTLGALSLTGNSGYRTGLPGVIHVPEEGAALADELE-------RLILAAGGDEIAAVIVEP


                         .         .         .         +         .         .         .:280
query           VVGNAGVLVPTEDFLKALHEAREFGVLLIADEVMTGFRLAFGGATELLGLKPDXXXXXXXXXXXXXXXXX
PF00202         IQGEGGVIPPPPGFLKALRECDEHGILLIFDEVQTGFRTGKLFAFEHYGVTPDIVTLAKGLGGGLPLGAV


                         .         *         .         .         .         .         +:350
query           XXRREIMEKVAPLGPVYQAGTLSGNPXXXXXXXXXXXXXXXNPGYYRYLEDLGARLERGLKEVLAQKxxx
PF00202         LGRAEIMDAFAPGGPLH-GGTFGGNP-LACAAALAVLDILEEEGLLENAAELGAYLREGLEE-LAEK---


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00202         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxx
PF00202         -------