[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS80932.1

[Show Plain Result]


## Summary of Sequence Search
    1::283
   70::203     2e-12  32%  210 aa  PF02645 DegV "Uncharacterised protein, DegV family COG1307"
    1::283

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02645         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02645         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGF
PF02645         ----FEEIVERLEELREKTRLYFVVDDLDYLVKGGRISKAAALIGSLLNIKPILTVDDGGLVPVAKVRGR


                         .         .         .         +         .         .         .:280
query           AEGIRKVAALFRRDFLEEARVYLAHAENPXXXXXXXXXXXXXXVEVLGALPAGAAVSVHTGPGTVxxxxx
PF02645         KKALKKLVELIEERLAKVVRIAISHAEEEAEELKELLKEKFPDVEILIS-PIGPVIGTHTGPGAL-----


                         .         *         .         .         .         .         +:350
query           xxx
PF02645         ---