[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81022.1

[Show Plain Result]


## Summary of Sequence Search
    1::434
    3::195     1e-45  54%  196 aa  PF00448 SRP54 "SRP54-type protein, GTPase domain"
    4::101     7e-23  54%  101 aa  PF02978 SRP_SPB "Signal peptide binding domain"
    6::67      0.001  39%  197 aa  PF07015 VirC1 "VirC1 protein"
    1::434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00448         ----------------------------------------------------------------------
PF02978         ----------------------------------------------------------------------
PF07015         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
PF00448         -----------------------------VILLVGVNGVGKTTTIAKLAARLKKKGKKVLLVAADTFRAA
PF02978         ----------------------------------------------------------------------
PF07015         -------------------------------FASGKGGAGKTTAAVNLASALAARGARVGLIDADPNRPL


                         +         .         .         .         .         *         .:210
query           AREQLRVLGEKVGVPVLEVQDGESPESIXXXXXXXXXXXXXXXXXXXTAGRLQIDERLMEELVRLKAALR
PF00448         AVEQLKTWGERLGVPVFAQGTGADPAAVAKDAIEAAKARGYDVVLIDTAGRLQNDENLMEELKKIKRVIA
PF02978         ----------------------------------------------------------------------
PF07015         ARWAENALRSGTWDPLCEVYAAE-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           PDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLE
PF00448         PDEVLLVLDATTGQDAVNQAKAFNEALGLTGVILTKLDGTAKGGAALSIAAVTGKPIKFIGVGEKVDDLE
PF02978         ----------------------------------------------------------------------
PF07015         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PFYPDRLAGRILxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEDFLKQMQNLKRLGSFSELLKLLPGVGR
PF00448         PFDPDRFVSRLL----------------------------------------------------------
PF02978         -----------------------------------------LNDFLEQLQQIKKMGPLSKIMGMIPGMGK
PF07015         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ALPQGFQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMxxx
PF00448         ----------------------------------------------------------------------
PF02978         MLPSGAQEDEKKLKRMEAIIDSMTPEERENPELLNGSRKRRIARGSGTSVQEVNELLKQFRQMRKMM---
PF07015         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxx
PF00448         --------------
PF02978         --------------
PF07015         --------------