[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81035.1

[Show Plain Result]


## Summary of Sequence Search
    1::433
   42::119     6e-06  38%  207 aa  PF01972 SDH_sah "Serine dehydrogenase proteinase"
    1::433

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAFLIDT
PF01972         ---------------------------------------------------------------IDLILHT


                         .         .         *         .         .         .         .:140
query           PGGRVDAAIRISDRILQTPLPTLAVVQNAFSAGALIALSCRQIVMLPGSEIGAALPVVALPLQEPQAADQ
PF01972         PGGLVLAAEQIARALREHPAKVTVIVPHAMSAGTLIALAADEIVMDPNAVLGPVDPQLG---QYPAASIL


                         +         .         .         .         .         *         .:210
query           KVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01972         KVV-------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01972         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01972         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01972         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxx
PF01972         -------------