[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81265.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
  228::352     3e-04  35%  353 aa  PF09002 DUF1887 "Domain of unknown function (DUF1887)"
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09002         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09002         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09002         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxQNFLTGGWLERYVAERLRKYLRSKNLPHEVAVGYQVTLPGGEAMELDVLVRVGERFYWFEAKTGEF
PF09002         ----RRFLNGGWLEELVYSTVKEI---KDI-QDVSLNVQVYRNLGEKNELDVVFVKDNKLHIIECKTGGM


                         .         *         .         .         .         .         +:350
query           QAHIAKYAGLKKVLGLSQKESFLVLLGMDRARAKELSALHGLTVVNQANFLEAxxxxxxxxx
PF09002         RDELYKLESLRDLLGGLNARAILVPLRHNITRAKDLGALIGPDELKDANKLNA---------