[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81275.1

[Show Plain Result]


## Summary of Sequence Search
    1::618
    3::362     8e-88  50%  363 aa  PF09334 tRNA-synt_1g "tRNA synthetases class I (M)"
    1::98      2e-20  54%  100 aa  PF01588 tRNA_bind "Putative tRNA binding domain"
   31::172     6e-13  31%  593 aa  PF00133 tRNA-synt_1 "tRNA synthetases class I (I, L, M and V)"
   13::92      7e-07  36%  300 aa  PF01406 tRNA-synt_1e "tRNA synthetases class I (C) catalytic
   13::105     1e-04  34%  153 aa  PF08264 Anticodon_1 "Anticodon-binding domain"
    1::618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
PF09334         ------ITTAIPYANGKPHLGHAYTYIAADVLARYQRLRGYDVLFLTGTDEHGTPIELKAEKEGITPQEL
PF01588         ----------------------------------------------------------------------
PF00133         ------------YANGSLHIGHALNYTIKDIIARYKRMQGYNVLYPPGWDCHGLPIELKVEKKREKCREW
PF01406         -----YVCGPTVYDYA--HIGHARTYVVFDVLRRYLRDFGYDVTYVRNITDVDDKIIKRAREEGESIREL
PF08264         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHXXXXXXXXXXXYEAGDIYYGEYEGLYCVSCERFYTEKELV
PF09334         VDKYHAEFKELFKKFGISFDNFIRTTSPEHKELVQEIFLRLYENGDIYKGEYEQWYCPSDETFLPDRQ-V
PF01588         ----------------------------------------------------------------------
PF00133         AEEYIGEIREQLKRLGLSWDREYFTMDPNYEAAVQWVFVKLYEKGLIYRGKRPVNWCPVCGTALADAEV-
PF01406         AERYIAAFHEDMDALNV-----------------------------------------------------
PF08264         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
PF09334         EGTCPARGDQCEVKEEEHYFFRLSKFQDRLLEWYESNPD---PPSRVNEIINWLKEGLQDLSISR---DL
PF01588         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
PF09334         DWGIPVPGDPGKVFYVWFDALIGYISALGYCDGEDFDKFWADLYHFIGKDIVRFHTIYWPAMLMALGLPL
PF01588         ----------------------------------------------------------------------
PF00133         ---------DTDVLDTWFDSGSWPFATLGWPEREEFEYFYPADLYVEGSDQIRGWFAS-SLMLSTAGKAP
PF01406         -----------------------------------------------GIDLIFPHHENEIAQSEAAGKPF
PF08264         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
PF09334         PKKVFAHGFLT-VEGGKMSKSRGNVVDPDDLLDRYGADALRYYLLREGPEGSDGDFSWEDFVERVNSDLA
PF01588         ----------------------------------------------------------------------
PF00133         FKNVLTHGLVLDEDGRKMSKSLGNVVDPLDVIDKYGADALRLWLASSDP-GRD-----------------
PF01406         ANYWMHNGFLT-IDGEKMSKSLGNFITIRDLLKKYDPEVLRLFLL-STHYRSPLNFSEEAL---------
PF08264         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DDLGNLVQRTxxxxxxxxxxxxxxxxxxxxxxxxxxxxKRLRPLVRELKFHVALEEAMAYVKALNRYINE
PF09334         NKLGNLVNRT------------------------------------------------------------
PF01588         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         --------------------------------------KKVTEAYENYRFNTALRAIMEFFDLCNWYIDE


                         .         .         +         .         .         .         .:490
query           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLxxxxxxxxxxxxxxx
PF09334         ----------------------------------------------------------------------
PF01588         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         TKPWLLAKDEDSKAQTVLYEVLEALRLLAPFLPFTAEEIWQQLEELLGKEESVHL---------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRVAEVLAAEKHPNADRLLVLRLSLGNEERTVVSGIA
PF09334         ----------------------------------------------------------------------
PF01588         ---------------------------------LVVGKVLEAEKHPNADKLLVCQVDVGEEERQIVCGAP
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KWYRPEELVGKKVVLVANLKPAKLRGIESQGMILAAQEGEALALVTVEGEVPPGxxxx
PF09334         ----------------------------------------------------------
PF01588         NFYEPEVLVGKPGVVVANLKPRKLRGVESEGMICSAREDDHDGILVLPEDAPPG----
PF00133         ----------------------------------------------------------
PF01406         ----------------------------------------------------------
PF08264         ----------------------------------------------------------