[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81311.1

[Show Plain Result]


## Summary of Sequence Search
    1::259
    3::22      3e-04  85%   23 aa  PF12399 BCA_ABC_TP_C "Branched-chain amino acid ATP-binding
    1::56      6e-04  43%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTFFNLLTGIYTPDEGRILFLGQDITGS
PF12399         ----------------------------------------------------------------------
PF00005         ------------------------------------------STLLRLLAGLLKPTSGKILLDGVI----


                         .         .         *         .         .         .         .:140
query           TPDKAAKLGIGRTFQNIRLFGAMTVLENILVGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF12399         ----------------------------------------------------------------------
PF00005         SPLELRKLRIGYVFQDPALFPHLTVRENIAFG--------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF12399         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxIAEGKPEEVRTNPRVIEAYLxxxxxxxxx
PF12399         --------------------IAEGTPEEIRNNPRVIEAYL---------
PF00005         -------------------------------------------------