[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81497.1

[Show Plain Result]


## Summary of Sequence Search
    1::725
    2::96      2e-15  48%   97 aa  PF00586 AIRS "AIR synthase related protein, N-terminal domain"
    9::124     4e-07  40%  148 aa  PF02769 AIRS_C "AIR synthase related protein, C-terminal domain"
    1::95      9e-05  40%   97 aa  PF00586 AIRS "AIR synthase related protein, N-terminal domain"(query 427->522)
    1::725

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGENAG
PF00586         -----------------------------------------------------------------GDDAA
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
PF00586         VIELPGGPELVLKVETHNHPTAIEPFGGAATAVGGAIRDLLAMGAKPLAGLDGFAVGKLLDPET---LEG
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VVSGIAFYGNAIGVPTVGGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGRDGIG
PF00586         IVAGIAAACNEAGVPLVGGE--------------------------------------------------
PF02769         ---------------------------------------------------------------TGPLGLG
PF00586         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GAAFASRELKEEKAEDRPAVQVGDPFLGKLLMEATLEAIELDLVEGVQDMGAAGLTSSLSELAHKSGLGV
PF00586         ----------------------------------------------------------------------
PF02769         GAGLALAR-KGLEAEGLP--QLGDALLEPTRIYVKLAALLRGLVHAATDITGGGLLGHLGEMAEASGVGA
PF00586         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ELHLDLVPTREEGMTPEELLLSESQERMVLVPKEGKEKALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         EIDLDKVPLFDELQSPLEMLFSETSGRLVVVPPEEAEAVL------------------------------
PF00586         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAMHALAEACRNVSVVGAKPLAYTDGLNLG
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ------GGDDAAVIELPGELVLTTDKVETHNHPTAIEPFGGAATAVGGAIRDLLAMGAKPLAGLDGFAVG


                         *         .         .         .         .         +         .:560
query           SPETPEGYHELAETIAGLKEASEALGVPVVSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         DPETLEG------IVAGIAAACNEAGVPLVGG--------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         -------------------------
PF02769         -------------------------
PF00586         -------------------------