[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81529.1

[Show Plain Result]


## Summary of Sequence Search
    1::503
    3::93      3e-30  63%   93 aa  PF00958 GMP_synt_C "GMP synthase C terminal domain"
   26::184     6e-24  38%  185 aa  PF00117 GATase "Glutamine amidotransferase class-I"
  103::214     7e-07  43%  214 aa  PF07722 Peptidase_C26 "Peptidase C26"
    2::32      9e-04  52%  348 aa  PF03054 tRNA_Me_trans "tRNA methyl transferase"
    1::503

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
PF00958         ----------------------------------------------------------------------
PF00117         ---------------------------VVPNDSDALEILLLNPDGILVSGGPGSPGDIEGKIEAIKYAEN
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
PF00958         ----------------------------------------------------------------------
PF00117         GVPVLGICLGMQLLAEAFGGKVVKAKVPHHGGNMRLGHDGPLFYGLPEVFYVRHRHSYEVNPLPEGLEVL
PF07722         GIPVLGICRGMQLLNVALGGTLDHREHPQDGPSHEVRIEGSLLARLLGEIMVNSLHHQAIKRLGPGLRVE
PF03054         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00958         ----------------------------------------------------------------------
PF00117         ATSEDGTIMAIVHKDNPFFGVQFHPESSSTPGGLHLLFNFFAL---------------------------
PF07722         ATAPDGLIEAIESPDAPYFGVQWHPE--------------------------------------------
PF03054         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         RVVVGMSGGVDSSVAAALLKEQGYDVIGVFM---------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLREWGLYE
PF00958         -------------------------------------------------------------IIKKAGLYD
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
PF00958         KIWQAFAVLLPVRSVGVQGDGRTYSYVVVLRAVITNDFMTADPAHIPYEVLEKISNRIINEVPGISRVVY
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DLTSKPPATIEWx
PF00958         DLTSKPPGTIEW-
PF00117         -------------
PF07722         -------------
PF03054         -------------