[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81530.1

[Show Plain Result]


## Summary of Sequence Search
    1::187
   41::111     9e-05  47%  112 aa  PF05685 DUF820 "Protein of unknown function (DUF820)"
    1::187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05685         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxPDLMAVCAPPPESPLYEEAPCLVVEVLSPATEGVDRREKLWRYLSLPSLEGYLLVSARE
PF05685         -----------PDVMVVIGEPKEPRQWEEAPDLVIEVLSPSTELTDLGKKLALYERL-GVPEYWIVDPKK


                         +         .         .         .         .         *         .:210
query           RRVELYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05685         RTVEVY-----------------------------------------