[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81541.1

[Show Plain Result]


## Summary of Sequence Search
    1::147
    2::81      1e-10  45%   85 aa  PF01035 DNA_binding_1 "6-O-methylguanine DNA methyltransferase, DNA
    1::147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPAR
PF01035         -------------------------------------------------------------------PFQ


                         .         .         *         .         .         .         .:140
query           LRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRVIHADGRLGGFQGQEGLKLWL
PF01035         RRVWDALRQIPYGKVTTYGDIAELLGRAARAVGRALGANPIPIIVPCHRVVGADGSLGGYAGGLERKRAL


                         +         .         .         .         .         *         .:210
query           LRFEGxx
PF01035         LELEG--