[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81542.1

[Show Plain Result]


## Summary of Sequence Search
    1::349
    3::95      5e-23  60%   96 aa  PF08486 SpoIID "Stage II sporulation protein"
    1::349

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08486         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxVEGGRLLLVNVLPLEDYLLGVLPAEMPASFPEEALKAQAVLARTFAVR
PF08486         ----------------------VEGGKLKLVNELDLEEYLAGVVASEMPASWPLEALKAQAVAARTYALA


                         +         .         .         .         .         *         .:210
query           RLNPLAPYDLCATEACQVYLGLSAETPRHERAVRATEGRVLSxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08486         RANRRNKFDVCDTTHCQVYQGYRAETKKIEEAVDATRGQVLT----------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08486         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08486         ---------------------------------------------------------------------