[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81585.1

[Show Plain Result]


## Summary of Sequence Search
    1::198
    2::185     2e-38  59%  188 aa  PF02223 Thymidylate_kin "Thymidylate kinase"
    1::84      5e-05  38%  223 aa  PF08433 KTI12 "Chromatin associated protein KTI12 "
    1::198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
PF02223         --------EGIDGSGKTTQIKLLAERLEAQGIKVVLTREPGGTPELIRELLLNEDLDPRTEALLFAADRA
PF08433         ---VLIILTGLPGSGKSTRARQLAKLLEAKRYKVHIVSDDDLRIP--RDVYDDSRSEKEARAVLYSA---


                         .         .         *         .         .         .         .:140
query           EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
PF02223         QHLEEVIKPALARGKIVICDRYIDSTLAYQGAGRGLDLDLVAQLNDFALGGLKPDLTLYLDVPPEVALAR
PF08433         ------VKRALSKGDLVI----LDSTNYIKGY--------------------------------------


                         +         .         .         .         .         *         .:210
query           VRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLPEEEIxxxxxxxxxxxxx
PF02223         ARELDRIEEEDLEFHERVREGYLELAAAEPERIVVIDASQSIEEV-------------
PF08433         ----------------------------------------------------------