[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81657.1

[Show Plain Result]


## Summary of Sequence Search
    1::61
   14::55      6e-09  69%   55 aa  PF00253 Ribosomal_S14 "Ribosomal protein S14p/S29e"
    1::61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASx
PF00253         ------------------RGRNRCRLTGRPRGVYRKFGLCRICFRELAHKGLIPGVKKAS-