[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81760.1

[Show Plain Result]


## Summary of Sequence Search
    1::113
    1::99      1e-15  42%   99 aa  PF02410 DUF143 "Domain of unknown function DUF143"
    1::113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQAXXXXXXXXXXXXXXRP
PF02410         ---------LLEEIVEALDDKKAEDIVVLDLRGKSSITDYMIIATGRSERHVRAIADELRRKLKEAGKLP


                         .         .         *         .         .         .         .:140
query           RPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWxxxxxx
PF02410         PRVEGLGEGWVLVDLGDVVVHVFTEEAREFYDLEKLW------