[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81794.1

[Show Plain Result]


## Summary of Sequence Search
    1::125
   13::74      6e-06  54%   79 aa  PF03061 4HBT "Thioesterase superfamily"
    1::125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR
PF03061         ----------------------------LDEARGAAAARASGRGVVTVEL-NIDYLRPVRVGDRLEVRAR


                         .         .         *         .         .         .         .:140
query           VVRVGRTSLTVEVEVYKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03061         VVRLGRRSATVEVEVRDE-------------------------------------