[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81826.1

[Show Plain Result]


## Summary of Sequence Search
    1::443
   59::272     2e-18  41%  275 aa  PF07992 Pyr_redox_2 "Pyridine nucleotide-disulphide oxidoreductase"
    1::70      1e-06  41%   78 aa  PF00070 Pyr_redox "Pyridine nucleotide-disulphide oxidoreductase"
    1::443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRTPEEFRK
PF07992         --------------------------------------------------------------RLLEQAKD
PF00070         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGE
PF07992         RGVEVLLGGEVTGIDPEGKTVTL---ADGETIEA--DAVVLATGARPRIPPIPGEELPGVGVLTSDDALE
PF00070         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTG
PF07992         --LRGKP--KRVVVVGGGNTGLELAGALARLGAEVTVVERRRRLLPALDAEEAAALAAELLKGGGAL-AE
PF00070         ----------KVAVVGGGPAGLEAAGVLARLGHKVTLVERRDRLGPQLDEEISKYLQERLEKLGVEVRLN


                         .         .         .         +         .         .         .:280
query           VKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAG
PF07992         TEVEGVDGVVGVKVVTGEEEEVDADLVAVGRGGVPPNLLLEAAGLELDERGRIVVDETLQTSVPGVFAAG
PF00070         TRVTEVEGDG------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07992         DVA-------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxx
PF07992         -----------------------
PF00070         -----------------------