[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81847.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
  137::253     1e-06  34%  271 aa  PF02653 BPD_transp_2 "Branched-chain amino acid transport system /
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02653         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02653         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxLVYAAFLLVPLTWWVLFKTPFGLRLRAVGEHPEAADTLGVNVHRMRYXXXXXXXXXXXXX
PF02653         ----------LVLLALVLALLLWLLLRRTRFGRALRAVGDNEEAARALGINVDRVKLLAFALSGALAGLA


                         .         .         .         +         .         .         .:280
query           XAYLSIGFLNQFVRGMSAGMGFIALAALIFGKWHPVGILFSTLLFGFASALAIQLQGxxxxxxxxxxxxx
PF02653         GALLAL-RLGSASPSMGFGLGLDAIAAVVLGGLGSIGAVLGALLLGLLENLGLALLG-------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02653         ---------------------------