[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81963.1

[Show Plain Result]


## Summary of Sequence Search
    1::361
    9::270     7e-38  44%  273 aa  PF00437 GSPII_E "Type II/IV secretion system protein"
    1::361

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEE
PF00437         ---------LLLEALDPGASDIHIN---PPVERIGGVLREVPF--LSEEELEALISRIASLAGRDISEKR


                         .         .         *         .         .         .         .:140
query           KELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGK
PF00437         PPQDGR--LPGDGRFRVSTPPTSEGESIVIRKPSSKPLTLEDLGLPGTLSELRRAARGLILVTGPTGSGK


                         +         .         .         .         .         *         .:210
query           STTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMR
PF00437         TTTLAALLDYINENGE-RIITIEDPIELQLPHPNQVQLQRRVGRDGVTFADALRAALRQDPDVILVGEIR


                         .         .         .         +         .         .         .:280
query           DYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLxxxxxxx
PF00437         DLETAELALQAAETGHLVLSTLHANSAAEAIDRLIDLGPEVEQELIR----SSLAGVIVQRLL-------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00437         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxx
PF00437         -----------