[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81982.1

[Show Plain Result]


## Summary of Sequence Search
    1::414
    1::179     4e-14  51%  187 aa  PF08245 Mur_ligase_M "Mur ligase middle domain"
    1::414

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVGGTNGKGTTARTLAAILEEAGFRVGLYTSP
PF08245         ---------------------------------------VTGTNGKTTTTAMLAAILSAAGLRVGTYG--


                         .         .         *         .         .         .         .:140
query           HLVDFRERIQVQGRPIXXXXXXXXXXXXXXXXXXXXXSFFEAATALALLHFAREGVEFAVLEVGLGGRLD
PF08245         --LNTNEEI---GLP----------------------------AALALL--AEAGVDVAVLEVGSGGRLD


                         +         .         .         .         .         *         .:210
query           ATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEGLGVLRAEALARKTPLWVL
PF08245         AT-ILKPDVAVITNIGPDHLDRLG-TLEAIAAAKAGIFKDGVAVLNADDPE-LAELAAKAGARVVTFGLD


                         .         .         .         +         .         .         .:280
query           GEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQAENxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08245         EDDVRADDITVSADGGAFT--LVTPGGELEVTLPLPGRHNVYN---------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08245         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08245         ----------------------------------------------------------------