[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS81992.1

[Show Plain Result]


## Summary of Sequence Search
    1::220
    8::155     2e-20  41%  156 aa  PF00174 Oxidored_molyb "Oxidoreductase molybdopterin binding
    1::220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAKEAWRLEVTGLVETPLVLTYEDLLARP
PF00174         -----------------------------------------VDPDDWRLTVDGLVERPLTLSLDDLRALP


                         .         .         *         .         .         .         .:140
query           QVELTRDFHCVTRWSRLDVTWKGVRTRDLXXXXXXXXXXXXXXXESYGGYTTNXXXXXXXXXXXXXAHTL
PF00174         QVEVTTRLQCVNQWSAGNATWTGVPLRDLLKKAGVKPGAKYVVFEGAGGYGASIPLEDALDPDVILAYEM


                         +         .         .         .         .         *         .:210
query           FGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVLLDHLELGFWExxxxxxxxxxxxxxxxxxxxxxxxxx
PF00174         NGEPLPPDHGYPLRLVVPGKYGAKSVKWLVRIEVTDEESPGYWE--------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxx
PF00174         ----------