[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS82142.1

[Show Plain Result]


## Summary of Sequence Search
    1::285
   30::153     5e-04  27%  207 aa  PF03466 LysR_substrate "LysR substrate binding domain"
    1::285

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03466         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAG
PF03466         --------------------------------------RYPGVRLELVEGDSADLLDLLREGEIDLAIRY


                         +         .         .         .         .         *         .:210
query           LKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALKEEXXXXXXXXXXXXXYEAFMEVFRRAGFAP
PF03466         GPLDDPGLVARPLGEEPLVLVASPDHPLARGEPLTLEDLAGHPLILLPPGSGTR--DLLDRALAEAGLRP


                         .         .         .         +         .         .         .:280
query           KVVREVARFSQAVSLVAAGLGVHLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03466         RVVLEVNSLEALLAAVAAGLGIAL----------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxx
PF03466         -----