[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS82156.1

[Show Plain Result]


## Summary of Sequence Search
    1::261
    1::250     5e-18  35%  254 aa  PF02673 BacA "Bacitracin resistance protein BacA"
    1::261

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxEALLLGVVEGLTEFLPVXXXXXXXXXXXXXXXPVEEDPFLKTFLVAIQLGAILAVLLLYGXXX
PF02673         -------KAIILGIVQGLTEFLPVSSTGHLILVPHLLGL---DGDFGLAFDVVIQLGTILAVLVLFRSER


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXVAFVPTGVIGFFFYPLIKGVILGNDXXXXXXXXXXXXXXXXXDRLAERAQYQDVKALPL
PF02673         TADRRLAWLIIIATIPAGVLGLLFKDFIEE-LLRNPLVVAIALIVGGILLILAERLRRR-RVKDLDDLTY


                         +         .         .         .         .         *         .:210
query           ARVAWIGVFQGLAALFPGTSRSGATIXXXXXXXXNRQAAAEFSFLLALPTMFAAVGYDLWKSAPEVPEGG
PF02673         KDALIIGLAQALA-LIPGTSRSGATISGGLLLGLSREAAAEFSFLLAIPAMLGAGLLKLLKLFEALSAGD


                         .         .         .         +         .         .         .:280
query           WSXXXXXXXXXXXXXXVTVRWMLAFVARHGFRPFALYRMALxxxxxxxxxx
PF02673         LGPLLVGFVVAFIVAYLAIKWLLRYLKRHSFKPFAIYRIIL----------