[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS82166.1

[Show Plain Result]


## Summary of Sequence Search
    1::536
    5::63      4e-11  49%   74 aa  PF00575 S1 "S1 RNA binding domain"
    4::71      7e-10  47%   74 aa  PF00575 S1 "S1 RNA binding domain"(query 293->361)
    5::72      6e-07  43%   74 aa  PF00575 S1 "S1 RNA binding domain"(query 33->102)
    1::536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPL
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         --------------------------------GNIYLGKVTRVEPFGAFVDLGGGKEGFLHISELSPDRV


                         .         .         *         .         .         .         .:140
query           SEEELRNLLSPGDEVKVQVLRVDPETGQILLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         EDPE--DVLKVGDEVKVKVLKVDRGTKGISLS--------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVL
PF00575         ----------------------------------------------------------------------
PF00575         ------------VGNIYLGKVTRVEPFGAFVDLGGGKEGFLHISELS-PDRVEDPEDVLKVGDEVKVKVL
PF00575         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RLDPEERRLSLxxxxxxxxxxxxxxxxxxxGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN
PF00575         ------------------------------GNIYLGKVTRVEPFGAFVDLGGGKEGFLHISELSPDRVED
PF00575         KVDRGTKGISL-----------------------------------------------------------
PF00575         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PAALFKKGDEMEVVVLNIDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         PEDVLKVGDEVKVKVLKVD---------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00575         ----------------------------------------------
PF00575         ----------------------------------------------
PF00575         ----------------------------------------------