[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tthe0:AAS82289.1

[Show Plain Result]


## Summary of Sequence Search
    1::223
    7::114     2e-25  52%  117 aa  PF02391 MoaE "MoaE protein"
    4::79      5e-09  59%   79 aa  PF02597 ThiS "ThiS family"
    1::74      3e-04  38%   84 aa  PF03658 UPF0125 "Uncharacterised protein family (UPF0125)"
    1::223

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEV
PF02391         ----------------------------------------------------------------------
PF02597         -------FASLRELAGEEEE--ELPEGATVAELLEALEERYPGLAETRSYVAVAPRLDGLDTELKDGDEV
PF03658         IRVEV-VYALPERQY---LLTLQVPEGATVEEAIRALLEQFPEIDLKKNKVGIFGKLVKLDDVLQDGDRV


                         .         .         *         .         .         .         .:140
query           AFLPPVSGGxxxxxxxxEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMA
PF02391         -----------------EPFDVGEEIAAVADPSAGAVVTFVGTVRDHNEGKAVEALEYEAYPGMAEKKLE
PF02597         ALLPPVSGG-------------------------------------------------------------
PF03658         EIYRPL----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKxxxxxxxxxxxxxxx
PF02391         EIAEEARERWPLIRVAVIHRVGRLEVGDDIVLVAVSSAHRKEAFEACEFLIDRLK---------------
PF02597         ----------------------------------------------------------------------
PF03658         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxx
PF02391         -------------
PF02597         -------------
PF03658         -------------