[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1urdA.bssp"
#ERROR : Can't open dsspfile "1j1nA.bssp"
#ERROR : Can't open dsspfile "1a7lA.bssp"
#ERROR : Can't open dsspfile "1eu8A.bssp"
#ERROR : Can't open dsspfile "1eljA.bssp"
#ERROR : Can't open dsspfile "1a99A.bssp"
#ERROR : Can't open dsspfile "1potA.bssp"
#ERROR : Can't open dsspfile "1y4tA.bssp"
#ERROR : Can't open dsspfile "1xvxA.bssp"
#ERROR : Can't open dsspfile "1pc3A.bssp"
#ERROR : Can't open dsspfile "1z21A1.bssp"
#ERROR : Can't open dsspfile "1q35A.bssp"
#ERROR : Can't open dsspfile "2ajfE1.bssp"
#ERROR : Can't open dsspfile "1d9vA.bssp"
#ERROR : Can't open dsspfile "1twyA.bssp"
#ERROR : Can't open dsspfile "1onwA2.bssp"
#ERROR : Can't open dsspfile "2thiA.bssp"
#ERROR : Can't open dsspfile "1eyzA3.bssp"
#ERROR : Can't open dsspfile "1eucB2.bssp"

## Summary of PDB Search
:417
    3e-40  19%  1urdA  [c.94.1.1] MALTOSE-BINDING PROTEIN
    1e-39   9%  1j1nA  [c.94.1.1] ALGQ2
    3e-39  19%  1a7lA  [c.94.1.1] MALE-B363
    9e-37  22%  1eu8A  [c.94.1.1] TREHALOSE/MALTOSE BINDING PROTEIN
    1e-36  16%  1eljA  [c.94.1.1] MALTODEXTRIN-BINDING PROTEIN
    7e-29  13%  1a99A  [c.94.1.1] PUTRESCINE-BINDING PROTEIN
    1e-24  15%  1potA  [c.94.1.1] SPERMIDINE/PUTRESCINE-BINDING PROTEIN
    3e-16  14%  1y4tA  [c.94.1.1] PUTATIVE IRON-UPTAKE ABC TRANSPORT SYSTEM
    8e-13  13%  1xvxA  [c.94.1.1] YFUA
    5e-12  11%  1pc3A  [c.94.1.1] PHOSPHATE-BINDING PROTEIN 1
    4e-11  13%  1z21A1 [a.243.1.2] YOP PROTEINS TRANSLOCATION PROTEIN H A:42 -- 145
    5e-07  23%  1q35A  [c.94.1.1] IRON BINDING PROTEIN FBPA
    8e-07  11%  2ajfE1 [d.318.1.1] SARS-CORONAVIRUS SPIKE PROTEIN E:323 -- 502
    2e-06  17%  1d9vA  [c.94.1.1] PROTEIN (IRON-UTILIZATION PERIPLASMIC PROTEIN)
    7e-05  16%  1twyA  [c.94.1.1] ABC TRANSPORTER, PERIPLASMIC SUBSTRATE-BINDING
    2e-04  22%  1onwA2 [c.1.9.13] ISOASPARTYL DIPEPTIDASE A:63 -- 346
    2e-04  31%  2thiA  [c.94.1.1] THIAMINASE I
    7e-04  16%  1eyzA3 [d.142.1.2] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
    8e-04  41%  1eucB2 [d.142.1.4] SUCCINYL-COA SYNTHETASE, BETA CHAIN B:0 -- 245
:417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxARAKVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPV
1urdA           ------------------------------------TVWS-WQTGPELQDVKQIAAQWAKAH-GDKVIVV
1j1nA           -----------------------------TDKPLTLKIHMHFRDKWVWDENW-PVAKESFRLTNVKLQSV
1a7lA           --------------------------------EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
1eu8A           --------------------------------EGKIVFAV-GGAPNEIEYWKGVIAEFEKKYPGVTVERQ
1eljA           -----------------------------KIEEGKVVIWH-AMQPNELEVFQSLAEEYMALXPEVEIVFE
1a99A           --------------------------------------------NWSDYIAPDTVANFEK-ETGIKVVYD
1potA           --------------------------------------------NWTEYVPPGLLEQFTKET-GIKVIYS
1y4tA           --------------------------------------------ARHYNADFEIIKKFEE-KTGIKVNHT
1xvxA           --------------------------------------------AQHENLVKSWVDGFTKDTGIKVT--L
1pc3A           ----------------------------------------------------------------------
1z21A1          ----------------------------------------------------------------------
1q35A           ----------------------------------------------------------------------
2ajfE1          ---------------------------------------------------GDDVRQIAPGQTGVIADYN
1d9vA           ----------------------------------------------------------------------
1twyA           ----------------------------------------------------------------------
1onwA2          ----------------------------------------------------------------QALEFA
2thiA           ----------------------------------------------------------------------
1eyzA3          ----------------------------------------------------------------------
1eucB2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYG
1urdA           DQSSNPKGFQFYATAARTGKGPDVVFGMPHDNNGVFAEEGLMPVPSGVLNTGLYAPNTIDAIKVNGTMYS
1j1nA           ANKAATNSQEQFNLMMASGDLPDVVGGDNLKDKFIQYGQEDQYAPHIKAFFKSHPEVERAIKAPDGNIYF
1a7lA           H---PDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
1eu8A           ATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIASGWLEPLDDYVQKSVFFQSVINLADKQGGKLYA
1eljA           QKPNL---EDALKAAIPTGQGPDLFIWAHDWIGKFAEAGLLEPIDEYEDLLNEFAPMAQDAMQYKGHYYA
1a99A           VFDSN---EVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSEWKNLDPELLKLVAKHDPDNKFA
1potA           TYESNETMYAKLKTY--KDGAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTFSNLDPDMLNKPFDPNNDYS
1y4tA           Q-AKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLE------EFIPAHLRDKDKEW
1xvxA           RNGGDSELGNQLVQEGSASPADVFLTENSPAMVLVDNAKLFAPLDA-------VTQAQVAQEYRPEHGRW
1pc3A           --------------------------------------------------------------------LA
1z21A1          ----------------------------------------------------------------------
1q35A           ----------------------------------------------------------------------
2ajfE1          YKLPDDFMGCVLAWN---TRNIDATSTGNYNKYRYLRHGKLRPFERDISNVPFSCTPPALNCYWPLNDYG
1d9vA           -----------------------------------------------------------KGVPLAPKKDW
1twyA           ----------------------------------------------------------------------
1onwA2          RKGGTIDITSSIDEPVAPAE--GIARAVQAGIPL---ARVTLSSDGNGSGVAGFE-TLLETVQVLVKDYD
2thiA           ----------------------------------------------------------LQGAKRNGEVYG
1eyzA3          ----------------------------------------------------------------------
1eucB2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKD
1urdA           VPVSVQVAAIYYNKKLVPQP----PQTWAEFVKDANAHGFMYDQANLYFDYAIIGGYGGYFKDNNGTLDP
1j1nA           IPYVVVARGYFIREDWLKKLNLKPPQNIDELYTVLKAFKEKDPNGNLVNFWGARSSGSDNYMDFYIDNGR
1a7lA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGGKYDI
1eu8A           LPVYIDAGLLYYRKDLLEKYGYSPPETWQELVEMAQKIQSGERETNPQYEGLVCDFVEYVYSNGGSLDGK
1eljA           LPFAAETVAIIYNKEMVSEP----PKTFDEMKAIMEKYYDPANEKYGIAWPINAYFISAIAQAFGGYYKT
1a99A           MPYMWATTGIGYNVDKVKAVLGENVDSWDLILKPENLEKLKSCGVSFL--DAPEEVFATVLNYLGKDPNS
1potA           IPYIWGATAIGVNGDAVDPKS---VTSWADLWKPEYK------GSLLLTDDAREVFQMALRKLGYSGNT-
1y4tA           FAITKRARIIAYNKNTNI--DISKMKNYEDLAKAEFK------GEIVMRSATAPYSKTLLASIIAND---
1xvxA           TGIAARSTVFVYNPEKISEAELP--KSIMDLAKPEWKGR-------WAASPSGADFQAIVSAMLELK---
1pc3A           AMYQGTIKTWDDPQIAALNPGVNLPTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGVDFPAVPG
1z21A1          ----------------------------------------------------------------------
1q35A           --------VIYTSKDRVGK--LPAGFDYLDLAKPEYK------GKVCVRSGKNSYNVSLFAAMIEHYGIE
2ajfE1          FY---TTTGIGYQPYRVVVLSF------------------------------------------------
1d9vA           IALSGRSRVVVYDHTKLSEK--DMEKSVLDYATPKWK------GKI----GYVSTSGAFLEQVVALSKMK
1twyA           ------------------------------------------DQKIAVVTREASSGTRYSFES---LXGL
1onwA2          FSISDALRPLTSS---------------------------------------------------------
2thiA           LPQILCTNLLFYRKGDLKIGQVDNIYELYK----------------------------------------
1eyzA3          -------------RLAAEELQLPTSTYESLFREAVADI----GYPCIV----------------------
1eucB2          ----------YQSKKLMSDNGVKVQRTANEALEAAKRLN-------------------------------


                         .         .         .         +         .         .         .:280
query           GKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLP
1urdA           NNIGLDTPGAVQAYTLMRDMVSKYHTPSTNGSIAKAEFLAGKIGMYV-SGPWDTADIEKAKIDFGVTPWP
1j1nA           VKHPWAETAFRDGMKHVAQWYKEGLIDKEIFTRREQMFGGNLGGFTHDWFASTMTFNEGLAPGFKLIPIA
1a7lA           KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYIAEAAFNKGETAMTINGP-WAWSNIDTSKVNYGVTVLP
1eu8A           WVPTLNKPENVEALQFMVDLIHKYKISPPTEEPVRLMFQQGNAAFERNWPYAWGLHNADDSPVKGKVGVA
1eljA           EQPGLDKPETIEGFKFFFTEIWPYMAPTGDYNTQQSIFLEGRAPMMVN-GPWSINDVKKAGINFGVVPLP
1a99A           T---KADDYTGPATDLLLKLRPNIRYF--HSSQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVS
1potA           ----TDPKEIEAAYNELKKLMPNVAA--FNSDNPANPYMEGEVNLGM-IWNGSAFVARQAGTPIDVVWPK
1y4tA           -----GNKEAKAWAKGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKVEVGNSLGI
1xvxA           -----GEKATLEWLKAMKTNFTAYKGNSTVMKAVNA--GQIDGGVIYHYYRFVDQAKGENSGKTQLHYFK
1pc3A           ALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAKTPANQAISM
1z21A1          ----------------------------------------------------------------------
1q35A           -----------KTKAFLE-GLKANLARKPQGGDRDQVKAIK--EGICDYSIGNSYYYGKMLDDWAEAAII
2ajfE1          ----------------------------------------------------------------------
1d9vA           GD-----KVALNWLKGLKENGK---LYAKNSVALQAENGEVPAALINN---YYWYNLAKEKGVENLKSRL
1twyA           TKTVKDREVSDVAPTALVVNSNSXXKTLVNHN---------TQAVGFISIGSVDKSVKAIQFEKADPTSD
1onwA2          ----------------------------------------------------------------------
2thiA           ----------------------------------------------------------------------
1eyzA3          ----------------------------------------------------------------------
1eucB2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYA
1urdA           TLPNGKHATPFLGVITAFVNKES--KTQAADWSLVQALTSAQAQQMYFRDSQQIPALLSVQRSS----AV
1j1nA           PPTNSKGQRWEEDSRQKVRPDGWAIKNPVETIKFFDFYFSRPGRDISNFGVPGVTYDIKNGKAVFKDSVL
1a7lA           T-FKGQPSKPFVGVLSAGINAAS--PNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEE----EL
1eu8A           PLPHGHKSAATLGGWHIGISKYS--DNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDP---AVV
1eljA           KDGKEYWPRPYGGVKLIYFAAGI--KNKDAAWKFAKWLTTSEESIKTLALELGYIPVLTKVLDD---PEI
1a99A           FSIPKEGAM--AFFDVFAMPADA--KNKDEAYQFLNYLLRPDVVAHISDHVFYANANKAATPLV--SAEV
1potA           EGG-------IFWMDSLAIPANAKNKEGA--LKLINFLLRPDVAKQVAETIGYPTPNLAARKLL--SPEV
1y4tA           IFPNQDNRGTHINISGIAMTKSSKNQDAA--KKFMEFMLSPEIQKILTDSNYEFPIRNDVELSQTVKDFG
1xvxA           HQDPGAF----VSISGGGVL--ASSKHPKEAQEFVKWITGKSGQDILRTNNAFYAVGVDAASNPKLVPLK
1pc3A           IDGPAPDGYPIINYEYAIVNNRQKDAATATLQAFLHWAITDGNKASFLDQVHFQPLPPAVVK--------
1z21A1          -------------EKTREVLWQQYYASNPPDHAVLEVLATPVREALLARFGQHQGSVVPAIDLPELRSVL
1q35A           NFPSGEHGTHKISGVVIA----KHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWG
2ajfE1          ----------------------------------------------------------------------
1d9vA           YFVRHQDPGALVSYSGAAVLKASKNQAEA--QKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYE
1twyA           --NIAKHTYQLSRPFLILHYS---DNADEQTKEFIAFLKSESAKKLIVEY-GYI----------------
1onwA2          ----------------------------------------------------------------------
2thiA           ----------------------------------------------------------------------
1eyzA3          ----------------------------------------------------------------------
1eucB2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSxxx
1urdA           QSSPTFKAFVEQLRYAVPMPNIPQMQAV--WQAMSILQNIIAGKVSPEQGAKDFVQNIQKGI-----
1j1nA           KSPQPVNNQLYDMGAQIPIGFWQDYDYER-QWTTPEAQAGIDMYVKGKYVMPGFEGVNMTREER---
1a7lA           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDEALKDGSQDPRVRG-----
1eu8A           SKSPHLKELRAVFENAVPRPIVPYYPQL-SEIIQKYVNSALAGKISPQEALDKAQKEAEELV-----
1eljA           KNDPVIYGFGQAVQHAYLMPKSPKMSAVW-GGVDGAINEILQDPADIEGILKKYQQEILNNM-----
1a99A           RENPGIYPPADVRAKLFTLKVQDPKIDRVRTRAWTKVK-----------------------------
1potA           ANDKTLYPDAETIKNGEWQNDVGAASS-IYEEYYQKLKAG---------------------------
1y4tA           TFKED--QIPVSKIAENIKEAVKIYDEV---------------------------------------
1xvxA           DLDAPKVEP----------------------------------------------------------
1pc3A           -------------------------------------------------------------------
1z21A1          QQFDSFGKRWEAILLQVLEGILPYLSEL---------------------------------------
1q35A           TFKSDTIKL---EDIAKYEAALKLVDEVKFD------------------------------------
2ajfE1          -------------------------------------------------------------------
1d9vA           KLEAP--------------------------------------------------------------
1twyA           -------------------------------------------------------------------
1onwA2          -------------------------------------------------------------------
2thiA           -------------------------------------------------------------------
1eyzA3          -------------------------------------------------------------------
1eucB2          -------------------------------------------------------------------