[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80360.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1aorA2.bssp"
#ERROR : Can't open dsspfile "1b25A1.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"

## Summary of PDB Search
:620
    2e-53  39%  1aorA2 [d.152.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:1 -- 210
    2e-43  25%  1b25A1 [a.110.1.1] PROTEIN (FORMALDEHYDE FERREDOXIN OXIDOREDUCTASE)
    5e-10  21%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605
:620

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxGYHDRVAFVDLSTGKVWYESFGEAFWXXXXXXXXXXXXXXXXHVPKGADPLGPENALVFAPGILTGT
1aorA2          ---GNWGRFIRVNLSTGDIKVEEYDEELAKKWLGSRGLAIYLLLKEMDPTVDPLSPENKLIIAAGPLTGT
1b25A1          ----------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PISGSGRNTVAAKSPLTXXXXXXXXXXXXXXXLKNAGLDALVVLGQAEAPVYLHVEGGKVALHPAVHLWG
1aorA2          SAPTGGRYNVVTKSPLTGFITMANSGGYFGAELKFAGYDAIVVEGKAEKPVYIYIKDEHIEIRDASHIWG
1b25A1          ----------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDLAHFAGRGGLGAVMGAKRLKAVSARAHKExx
1aorA2          KKVSETEATIRKEVGEKVKIASIGPAGENLVKFAAIMNDGHRAAGRGGVGAVMGSKNLKAIAVEGSKT--
1b25A1          ----------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxHDPGLLKELARRMAKERMDRAAGLVTMGTVGTVKPFNLRGVLPSHNFLDGFSEGAEALDGTSLDALG
1aorA2          ----------------------------------------------------------------------
1b25A1          ----DKEELKKLSQEAYNENSPGYPFWKRQGTMAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTME--G
1aorA1          ---ADKQKFMLVVREKVNKLRNDPGGLPKYGTAVLVNIINENGLYPVKNFQTGVYPYAYEQSGEAMAAKY


                         .         *         .         .         .         .         +:350
query           IRIGRDTCYACAIRCKQVVKIEGTGKYDVRXXXXXXXXXXXXXXXSTCGVTDPYAVTKANTLCNQYGLDV
1aorA2          ----------------------------------------------------------------------
1b25A1          MKVQQRGCPYCNMPCGNVVLDAEG-------QESELDYENVALLGSNLGIGKLNEVSVLNRIADEMGMDT
1aorA1          LVRN-KPCYACPIGCGRVNRLPTVGETEGPEYESVWALGANLGINDLAEANHMCDELGLDTISTGGTLAT


                         .         .         .         .         *         .         .:420
query           IGVGVTIACAMEAVEKGYLDDEGLGLRFGNGDALIAAIXXXXXXXXXXXXXXXXXXKRLAESLGHPELAM
1aorA2          ----------------------------------------------------------------------
1b25A1          ISLGVSIAHVMEAVERGILKEGP---TFGDFKGAKQLALDIAYRKGELGNLAAEGVKAMAEKLGTHDFAM
1aorA1          AMELYEKGHIKDEELGDAPPFRWGNTEVLHYYIEKIAK------REGFGDKLAEGSYRLAESYGHPELSM


                         .         .         +         .         .         .         .:490
query           HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPLPIEDLSEAKI
1aorA2          ----------------------------------------------------------------------
1b25A1          HVKGLEVSGYNCYIYPAMALAYGTSAIGAHHKEA---------WVIAWEIGTAPIEYKISYDPI---KAQ
1aorA1          TVKKLELPAYDPRGAEGHGLGY-----ATNNRGGCHIKNYMISPEILGYPYKMDPHDVSDDKIKMLILFQ


                         *         .         .         .         .         +         .:560
query           RMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVGERTLQLTRLFNLREGISPEE
1aorA2          ----------------------------------------------------------------------
1b25A1          KVVELQRLRGGLFEMLTACRLVGLSLDYYPKLLKAITGVTYTWDDLYKAADRVYSLIRAYWVREFNDRKM
1aorA1          DLTALIDSAGLCLFTTFG-----LGADDYRDLLNAALGWDFTTEDYLKIGERIWNAERLFNLKAGLDPAR


                         .         .         .         *         .         .         .:630
query           DRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEGGVDPERLRALGLEEFxxxxx
1aorA2          ------------------------------------------------------------
1b25A1          DYPPKRWFTEGLKSGPGEHLDEKKYDELLSEYYRIRGWRGIPKKETLKELDLDFV-----
1aorA1          DDTLPKRFLEEPMPEGPNKGHTVRLKEMLPRYYKLRGWDGKIPKEKLEELGIAEF-----