[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80391.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1fg3A.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "2govA1.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "1fhlA.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1s2bA.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "1w9gA1.bssp"
#ERROR : Can't open dsspfile "1sf2A.bssp"
#ERROR : Can't open dsspfile "1lk9A.bssp"
#ERROR : Can't open dsspfile "1v8dA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "2igsA1.bssp"
#ERROR : Can't open dsspfile "1gr0A2.bssp"
#ERROR : Can't open dsspfile "1gpcA.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "1qz8A.bssp"
#ERROR : Can't open dsspfile "1ynfA1.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1elqA.bssp"
#ERROR : Can't open dsspfile "1svvA.bssp"
#ERROR : Can't open dsspfile "1c4kA2.bssp"
#ERROR : Can't open dsspfile "1o61A.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"

## Summary of PDB Search
:397
    7e-51  33%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    2e-38  17%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    1e-31  16%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-31   9%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    4e-31  22%  1fg3A  [c.67.1.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    8e-30  19%  1aamA  [c.67.1.1] ASPARTATE AMINOTRANSFERASE
    1e-29  22%  1b5oA  [c.67.1.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    3e-29  14%  1d2fA  [c.67.1.3] MALY PROTEIN
    6e-28  14%  1c7nA  [c.67.1.3] CYSTALYSIN
    3e-27  16%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    3e-27  18%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    6e-27  11%  1c8nA  [b.121.4.7] COAT PROTEIN
    1e-26  10%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-25  14%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    1e-24  14%  1qz9A  [c.67.1.3] KYNURENINASE
    3e-24  15%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    6e-24  17%  1h1cA  [c.67.1.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-22  10%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    2e-22  12%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    7e-22  16%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    2e-21  12%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    8e-21  13%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    2e-19  11%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    8e-18  13%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    9e-18  11%  1ohvA  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    3e-17  11%  2govA1 [d.60.1.4] HEME-BINDING PROTEIN 1 A:7 -- 190
    5e-17  12%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    1e-16  15%  1fhlA  [c.1.8.3] BETA-1,4-GALACTANASE
    3e-16   8%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    1e-15  13%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    1e-15   8%  1s2bA  [b.29.1.20] SCYTALIDOPEPSIN B
    8e-15  12%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    7e-14  19%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    1e-13  13%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    1e-13  13%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    4e-13   4%  1w9gA1 [d.330.1.1] ENHANCER OF RUDIMENTARY HOMOLOG A:1 -- 103
    1e-12  16%  1sf2A  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    2e-12  13%  1lk9A  [c.67.1.1] ALLIIN LYASE
    2e-12  14%  1v8dA  [c.140.1.1] HYPOTHETICAL PROTEIN (TT1679)
    3e-12  10%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    5e-12  15%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    2e-11  12%  2igsA1 [d.2.1.11] HYPOTHETICAL PROTEIN A:4 -- 215
    3e-11  18%  1gr0A2 [d.81.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE A:201 -- 311
    6e-10   6%  1gpcA  [b.40.4.7] PROTEIN (CORE GP32)
    7e-10  14%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    7e-10  18%  1ei7A  [a.24.5.1] COAT PROTEIN
    4e-08   9%  1qz8A  [b.140.1.1] POLYPROTEIN 1AB
    3e-06  12%  1ynfA1 [d.126.1.7] SUCCINYLARGININE DIHYDROLASE A:2 -- 441
    4e-06  21%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
    8e-06  12%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    9e-06  23%  1elqA  [c.67.1.3] L-CYSTEINE/L-CYSTINE C-S LYASE
    1e-04  19%  1svvA  [c.67.1.1] THREONINE ALDOLASE
    2e-04  13%  1c4kA2 [c.67.1.5] PROTEIN (ORNITHINE DECARBOXYLASE) A:108 -- 569
    2e-04  19%  1o61A  [c.67.1.4] AMINOTRANSFERASE
    4e-04  19%  1bs0A  [c.67.1.4] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
1vp4A           ---VNLEGKISKIGQNXKSSIIREILKFAADKDAISFGGGVPDPETFPRKELAEIAKEIIEKEYHYTLQY
1u08A           -------------LPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGPRYLQE-----RLAHHVAQGANQY
1b8gA           ---------------GWQEYEKNPYHEVHNTNGIIQMGLAENLESWLAKNPEAAAFKKNGESIFAELALF
1cl1A           ---------------KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEA-----KKHATRNRANGEL
1fg3A           ----------------------------------------------------------------------
1aamA           ---------------------LADLFRADERPGKINLGIGVYTGKTPVLTSVKKAEQYLLENET--TKNY
1b5oA           ---------------AMKPSATVAVNAKALEVDLVALTAGEPDFDTPEHVKE-----AARRALAQGKTKY
1d2fA           ---------------------------------LLPFTISDMDFATAPCII------EALNQRLMHGVFG
1c7nA           ---------------------------PEVGNEVVPLSVADMEFKNPPELIEGL-------KKYLDETVL
1bw0A           ---------------GLVFNPIRTVSDNSPKP-IIKLSVGDPTLDKNLSAAQIKKLKEAIDSQE--CNGY
2gb3A1          ---------------LTEESPIRKLVPFAEXVRIHHLNIGQPDLKTPEVFFERIY--ENKPEVVYYSHSA
1c8nA           ----------------------------------------------------------------------
1dtyA           ---------------------------------------------------------------------F
1vefA1          ------------------------------NEYIDCVGGYGVANLGHGNPEVVEAVKRQAE-TLMAMPQT
1qz9A           --------------------TTRDCLALDAQDSLAPLRQQFALPEARPVAALARAQAVIAEEWGNGLIRS
1lc5A           -------------------------------DQLLDFSANINPLGMPVSVKRA------LIDNLD-CIER
1h1cA           ---------------------IAKRAYPYETRDKTYLALNENPFPFPEDLVD-----EVFRRLNSDALRI
2bwnA1          ---------------------------------ITVWCGNDYLGMGQHPVVLAAMH-EALEAVGAGSGGT
1v72A1          ------------------------------RPPALGFSSDNIAG------ASPEVAQALVKHSSGQAGPY
1iugA           ------------------------------------------------------------------PQLH
1h0cA           ------------------------------------------------------------------QMIG
1fc4A           --------------------------DITVADGVINFCANNY-LGLANHPDLIAAAKAGXDSHGFGXASV
1pmmA           ---------------PLHEMRDDVAFQIINDELYLDGNAATFCQTWDDENVHKLMDLSINKNWIDKEEYP
1b9hA           -------------------------------------------------------------------WWR
1ohvA           ----------------------------------------------------------------------
2govA1          ------------------------LFGSVETWPWQVLSTGGKEDVSYEERACEGGKFAT-VEVTDKPVDE
1xl7A1          ---------------------------------------------------------------------I
1fhlA           ----------------------------------------------------------------------
3bc8A1          ---------------------LHELAVMDSNNFLGNCGVGEREGRVASALVARRH--YRFIHGIGRQPKA
2e7iA1          ---------------------------------------------------------KLTEEARQALLEW
1s2bA           ----------------------------------------------------------------------
1mdoA           -------------------------------------------------------------------GWI
1cs1A           ----------------------------------------------------------------------
1c0nA           ---------------------------------------------------------------------H
2cfbA1          -------------------------------------------------------------------FGA
1w9gA1          ----------------------------------------------------------------------
1sf2A           ----------------------------------------------------------------------
1lk9A           ----------------------------------------------------------------------
1v8dA           ---------------------AEEFLQAFPMAPGSLFVLGGSTSEVLGTRPSLEAAHAVLEGLLPPLLEH
1agxA           -----------------------FFLNLVVHTDKPIVLVGSMRPSTALSADGPLNLYSAVAL---ASSNE
1gbnA           -------------------------------------------------------------DKLTLTSRA
2igsA1          ----------------------------------------------------------------------
1gr0A2          --------------------------------------------------------------------QV
1gpcA           --------------------------------------------------------------------EW
2fn6A1          --------------------------------------------------------------------QL
1ei7A           ----------------------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1ynfA1          ---------------------------------------------------------RVVLTEEERRAVN
1jg8A           ---------------------------------------------------------------------Y
1vk9A           ----------------------------------------------------------------------
1elqA           ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1c4kA2          ---------------------------------------------------------------------L
1o61A           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
1vp4A           STTEGDPVLKQQILKLTGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFV
1u08A           APMTGVQALREAIAQKQPDADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVK
1b8gA           QDYHGLPAFKKAMVDFVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEI
1cl1A           FYGRRGTLTHFSLQQAMCELGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLG
1fg3A           -PECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPTYGXYSVSAETIGVECR
1aamA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFLNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
1b5oA           APPAGIPELREALAEKFRREPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1d2fA           YSRWKNDEFLAAIAHWFSTQSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVM
1c7nA           GYTGPTEEYKKTVKKWMDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKII
1bw0A           FPTVGSPEAREAVATWWTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMH
2gb3A1          GIWELREAFASYYKRRQRVDPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI
1c8nA           ------------------VSNSELTPIALAYTVQSLPLIATQ--PAWLGTIADNYSKWRWVSLRIIPKCP
1dtyA           LADSGSVAVEVAMKMALQYWRDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMD
1vefA1          LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFAHTGRKKFVAAMRGFSGRTMGSLSVTWEPK
1qz9A           WNSAGWRDLSERLGNRLGARDGEVVVTDTTSINLFKVLSAARSPERRVIVTETSNFPTDLYIAEGLADML
1lc5A           YPDADYFHLHQALARHHQVPASWILAGNGETESIFTVA--SGLKPRRAMIVTPGFAEYGRALAQSGCEIR
1h1cA           YYDSPDEELIEKILSYLD-TDFLSKNNVSVGNGADEIIYVXXLXFDRSVFFPPTYSCYRIFAKAVGAKFL
2bwnA1          RNISGTTAYHRRLEAEIAGLKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
1v72A1          GTDELTAQVKRKFCEIFER-DVEVFLVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNG
1iugA           HRTEAAREARGLLREAFRTEGEVLILTGSGTLAMEALVKNLFAPGERVLVPVYGKFSERFYEIALEAGLV
1h0cA           SMSKDMYQIMDEIKEGITRNPLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVDIGERIGVH
1fc4A           RFICGTQDSHKELEQKLALGXEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRY
1pmmA           QSAAIDLRCVNMVADLWHAPQAVGTNTIGSSEACMLGGMAMKWRDKPNLVCGPVQICWHKFARYWDVELR
1b9hA           MGGDEVNSFEREFAAHHGA-AHALAVTNGTHALELALQVMGVGPGTEVIVPAFTFISSSQAAQRLGA--V
1ohvA           -----------------------------TMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKE
2govA1          ALREAMPKIMKYVGGTNDKGPVSFAVFPNEDGSLQKKLKVWFRIPNQFQGSPPAPSDES--VKIEEREGI
1xl7A1          SLDPENLTLLEKIQTSLFVYSIEDSSPHATPEEYSQVFEXLLGGDPSVRWGDKSYNLISFANGIFGCCCD
1fhlA           ---------------------------------------------------ALTYRGADISS-LLLLEDE
3bc8A1          AGSSLLNKITNSLVLNVIKLASCFVVPMATGTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPV
2e7iA1          PPI--HDFIHNQLPKFLGC--DVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIA
1s2bA           ----------------------------------DTCQTAILQTGFDWYGDGTYDAWY---------EWE
1mdoA           TTGPKNQELEAAFCRLTG-NQYAVAVSSATAGXHIALXALGIGEGDEVITPSXTWVSTLNXIVLLGANPV
1cs1A           ------------------------VLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGC
1c0nA           TLSAQATEKMENVRKRAARSAEELVFVRGTTEGINLWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVG
2cfbA1          PCLLENILAEMVIAAVPS--VEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHAATLTAPYN-
1w9gA1          ---------------------------------------------------SHTILLVQPTKRPEGRTYA
1sf2A           ----------------------------------------------------------------------
1lk9A           ----------------------------------------------------------------------
1v8dA           VAVQACEHLNRALVRETARAKEEVAVFPHPKAGGAKATAAFLRFRDPVMVESLKAQAHGGMDIGGHLRPV
1agxA           AKNKGVMVLMNDSIFAARDVHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQ
1gbnA           FYNNVLGEYEEYITKLFNY--HKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKTLSAISSSTDPTS
2igsA1          ----------------------------------------------------------------------
1gr0A2          ----GATITHRVLAKLVQLDRTMQLNVGGNMDFLNMLEDVHIGPSDHVGWLDDRKWAYVRLE---GRAFG
1gpcA           KLKLDNAGNGQAVIRFLQAPFAILVNHGFKKNG----KWYI-----------ETCSSTHGDYDSCPVCQY
2fn6A1          TQGKRSLLFEEALCEFLGV--KHALVFNSATSALLTLYRNFSEFSADIITTPISFVATANMLLESGYTPV
1ei7A           ---------------------ELINLCTNAQQARTVVQRQFSE----------VWKPSPQVTVRFPDSDF
1qz8A           --------------ELSPVALRQMSCAAGTTQTACTDAYYNNSKGGRFVLSDHQDLKWARFPKSDGTGTI
1ynfA1          PAVXXNDTLFNALNDWVDLTAADPQLLREGREALDVLSQLLNL---------------------------
1jg8A           GEDPTINELERLAAETFGK--EAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIEVGAMAVLSGVMPH
1vk9A           ----------------------------------------------------------------------
1elqA           ------AQLRQALAETFNVDPNTITITDNVTTGCDIVLWLDWHQGDEILCEHPGIIAIVQAIAARGITYR
1svvA           --------AARLIGELLERPDADVHFISGGTQTNLIACSLALRPWEAVIATQLGHTGAIEA---TGHKVV
1c4kA2          IHEGPAVAAEKHAARVYNAD-KTYFVLGGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNSALAMAPVYL
1o61A           ------------VKDYSKSEN--ALALNSATAALHLALRVGVKQDDIVLASSFTFIASVAPICYLKPVFI
1bs0A           --------LEEELAEWLGY--SRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLR


                         +         .         .         .         .         *         .:210
query           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
1vp4A           VVPLEDDGXDLSEFDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRY
1u08A           RMALQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINF
1b8gA           VPSSNGFQITETALEEAYQEAERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF
1cl1A           VTTSWFDPLIGADIVKHLQPNTK--IVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLF
1fg3A           TVPTLDNQLDLQGISDKLDGVK---VVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVA-DEAYIEFCP
1aamA           EYAYYDATLDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1b5oA           EVETLPEEGFVPDPERVRRAITPRKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLY
1d2fA           PVALEKQADDMGKLEAVLAKPECKIM-LLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVW
1c7nA           ECELLEKDGDFQKLEKLSK-DKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIM
1bw0A           FYNCRPENDWEADLDEIRRLKDDKKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVF
2gb3A1          PVTRRXEEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGKDEXRYLVEIAERHGLFLIVDEVYSEIVF
1c8nA           TTTSGTVAMCLSYDRNDVAP--GSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDK
1dtyA           GEWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGR
1vefA1          YREPFLPPYNDVEALKRAVDEETAAVILEPV-QGEGGVRPATPEFLRAAREITEKGALLILDEIQTGMGR
1qz9A           QQGYTLRLVDSPEELPQAIDQDTA-VVMLTHVNYKTGYMHDM---QALTALSHECGALAIWDLAHSAGAV
1lc5A           RWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIP
1h1cA           EVPLTKDLRIPEVNVGEGDV------VFIPNPNNPTGHVFEREEIERI----LKTGAFVALDEAYYEFHG
2bwnA1          KRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPI---KEICDIAEEFGALTYIDEVHAVGMY
1v72A1          AKLMTVDGPDIVRLRERTREKVTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANAL
1iugA           VERLDYPYGDTPRPEDVAKEGYA--GLLLVHSETSTGALADLPALARAFKE-KNPEGLVGADMVTSLLVG
1h0cA           PMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPL---DGFGELCHRYKCLLLVDSVASLGGT
1fc4A           RYAN----NDXQELEARLKEARHVLIATDG-VFSXDGVIANLKGVCDLAD---KYDALVXVDDSHAVGFV
1pmmA           EIPMRPGQMDPKRMIEACDENTI--GVVPTFGVTYTGNYEFPQPLHDALDKFQGIDIDMHIDAASGGFLA
1b9hA           TVPAATYNLDPEAVAAAVTPR--------TKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHGAR
1ohvA           NQQEEARCLEVEDLIVKYRKKKKTVGIIVEPIQSEGGDNHASDDFRKLRDISRKHGCAFLVDEVQTGGGS
2govA1          TVYSTQFGGYAKEADYVAHATQLR-TTLEGTPATYQGDVYYCAGYDPPMKPYGRRNEVWLVK--------
1xl7A1          HAPYDAVXVNIAHYVDERV--LETEGRWKGSEKVRDIPL------PEELVFTVDEKILNDVSQAKAQHLK
1fhlA           GYSYKNLNGQTQALETILADAGINSIR-QRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWA
3bc8A1          VIENVLEGDDLKAVEAKIQELGPEHILC-LHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSS
2e7iA1          LVPYPDYAITPENFAQTIEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRM
1s2bA           VSITISEGDSIQMSVTATSDTSGSATLE----NLTTGQKVSKSFSNESSGSLCRTAEFIIEDFEECNSNG
1mdoA           XVDVDRDTLXVTPEHIEAAITPQ---TKAIIPVHYAGAPADLDAIYALGE---RYGIPVIEDAAHATGTS
1cs1A           YRVLFVDQGDEQALRAAL-AEKPKLVL-VESPSNPLLRVVDIAKICHLAR---EVGAVSVVDNTFLSPAL
1c0nA           AELRVIPLNPDGTLQPTLFDAATRLLA-ITHVSNVLGTENPL---AEMITLAHQHGAKVLVDGAQAVMHH
2cfbA1          ------DLEAVSRLFEQY-PNDIAGVILEPV-VGNAGFIPPDAGFLEGLRELTQYGALLVFDEVMTGFRI
1w9gA1          DYE--SVNECMEGVCKMYEE-----HLKRMNPNSPSITYDISQLFDFIDDL--ADLSCLVYRADTQTYQP
1sf2A           ---------AIASIHRIFKNDAEDIAAIVIEPVQGEGGFYASSPAQRLRALCDEHGIMLIADEVQ----S
1lk9A           ----------------------------------------------------------------------
1v8dA           AVPLRLSVRKIGEAVLLAAKTRPKLVG-GARAVYTREE--MLKKLEEFL---------------------
1agxA           IVYGSDN-MMPDAYQAFAKAGVK--AIIHAGTGNGSMANYLV---PEVRKLHDEQGLQIVRSSRVAQGFV
1gbnA           YDGFGPFMPGFDALERALQDPNVAAFMVEP-IQGEAGVVVPDPGLMGVRELCTRHQVLFIADEIQTGLAR
2igsA1          -----------------LANIYKGFARQCNP-GFVFPEAQTIEAWDIPLRLHPEGGDISKADQQYSTLLA
1gr0A2          DVPLNLEY--------------------------------------------------------------
1gpcA           ISKNDLYNTDNKEYSLVKRKTSYWLVVKDPAAPENEGKVFKYRFGKKIWDKMIAVDVEMGETPVDVTCPW
2fn6A1          FAGIKNDGIDELALEKLINERTKAIV-----SVDYAGKSVEV---ESVQKLCKKHSLSFLSDSSHALGSE
1ei7A           KVYRYNAVPLVTALLGA--FDTRNRIIEVENQANPTTAETLDATRRVDDATVAIRINNLIVELIRGTGSY
1qz8A           YTELEPPCDTPKGPKV-KYLYFIK-GLNNLNRGMVLGSLAATVR--------------------------
1ynfA1          ----------------------------------------------------------------------
1jg8A           PVPGKNGAMDPDDVRKAIRPRRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGA----RI
1vk9A           --------NLLRSALKIFEKKDLSAYSGRSIFESKDSGLKPV---VELFKRFDNLEGSLVIDKXVGKAAA
1elqA           FFPVAATLNQGDAAAVLANHLGPKRLVILSHLLWNTGQVLPL---AEIMAVCRRHQ--------------
1svvA           TAPCPDGKLRVADIESALHENIPKLVYISNT--TEVGTQYTKQELEDISASCKEHGLYLFLDGAR-----
1c4kA2          QTNRNPYGAAKVDPERAKWKRPFRLAVIQLGTYDGT-----IYNAHEVVKRIGHLCDYIEFDSAFIPMMR
1o61A           DCDE-TYNIDVDLLKLAIKECEKKPKALILT--HLYGNAAKMDE---IVEICKENDIVLIEDAA------
1bs0A           RFAHN----DVTHLARLLASPCPGQMVVTEGVFSMDGDSAPLA---EIQQVTQQHNGWLMVDDAHGTGVI


                         .         .         .         +         .         .         .:280
query           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
1vp4A           EGETVDP---IFKIGGPERVVLLNTFSKVLAPGLRIGXVAGSKEFIRKIVQAKQSADLCSPAITHRLAAR
1u08A           SQQGHASVLAHPQLRER--AVAVSSFGKTYHTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALAD
1b8gA           SSPSFISVMEVLKDRNCDRVHVVYSLSKDLLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAM
1cl1A           K----------ALDFGIDVSIQAATXYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAYITSR
1fg3A           QASLAGWL------AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLXKVIAPYPLSTPVA-DIAAQA
1aamA           GLEEDAE-GLRAFAAMHKELIVASSYSKNFLYNERVGACTLVAADSETVDRAFSQMKAAIDAVATILSND
1b5oA           EGEHFSPGRVAP----EHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
1d2fA           GEQPHIPWSNVARGD---WALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALAH
1c7nA           PGYEHTVFQSIDEQL-ADKTITFTAPSKTFNAGMGMSNIIIKNPDIRERFTKSRDATSGMPFTTLGYKCE
1bw0A           KGKDPNATFTSVADFTVPRVILGGTAXNLVVPGWRLGWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQ
2gb3A1          R-GEFASALSIESDK----VVVIDSVSKFSACGARVGCLITRNEELISHAXKLAQGRLAPPLL-EQIGSV
1c8nA           AWYSTIGTAAFAAL--TAFDQNQFCPCTVHISDGGPAVAVPPGDIFFKY---------------------
1dtyA           TGKLFACEH-------AEIAPDILCLGKALTGTMTLSATLTTREVAETISDGEAGCFMHGPTFMGPLACA
1vefA1          TGKRFAFEHFGI-------VPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVA
1qz9A           PV----------DLHQAGADYAIGCTYKYLNGPGSQAFVWVSPQLCDLVPQPLSGWFGHSRQFAMEPRYE
1lc5A           HETGFIPALK-----DNPHIWVLRSLTKFYAPGLRLGYLVNSDDAAMAR-MRRQQMPWSVNALAALAGEV
1h1cA           ESYVDFLKK-------YENLAVIRTFSKAFSAAQRVGYVVASEKFIDAY--NRVRLPFNVSYVSQXFAKV
2bwnA1          GPRGAGVAER------DGLMHRIDIFNGTLAXAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAA
1v72A1          VSLGCSPAEMT---WKAGVDALSFGATKNGVAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDA
1iugA           EVALEA----------MGVDAAASGSQXGLMCPPGLGFVALSPRALERLKPRGYYLDLARELKAQKEGES
1h0cA           PLYMDRQGIDILYSNAPPGTFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYS
1fc4A           GENGRGSHEYCDVXGRV--DIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASI
1pmmA           PFVAPDIVWDFRL---PRVKSISASGHKFGLPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAYEFLR
1b9hA           WQGKRVGELDSI-------ATFSFQNGKLMTAG-EGGAVVFPDGETEKYETAFLRHSCGRPRDDRRYFHK
1ohvA           -----TGKFWAHEHWGLDDPADVMTFSK----KMMTGGFFHKEEFRPNAPYRIFNTW-LGDPSKNLLLAE
2govA1          ----------------------------------------------------------------------
1xl7A1          A---------------------------------------------------------------------
1fhlA           DPSDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFA-----------------------------------
3bc8A1          KCMHLIQQGARVGR---IDAFVQSLDXNFMVPVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLL
2e7iA1          P----------VSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSKEVELLGCTARGATIIT
1s2bA           SDCEFVPFASFSPAV-EFTDCSVTSDGESVSDDAQITQVIINNQDVTDCSVSGT----------------
1mdoA           YKGRHIGARG--------TAIFSFHAIKNITCA-EGGIVVTDNPQFADKLRSLKFHGLGVDQAEVDLNAA
1cs1A           QN---------PLALGADLVLHSCTXYLNGHSDVVAGVVIAKDPDVTELAWWANNIGVTGGAFDSYLLLR
1c0nA           PV----------DVQALDCDFYVFSGHKLYGTGIGILYVKEALLQEMPPWEGGGSMIATVSLSEGTTWTK
2cfbA1          AYGGAQEKFGV--------TPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPTLSGNPLAMTAGILEI
1w9gA1          YNKDWIKEKIY-----------------------------------------------------------
1sf2A           GAGRTGTLFAMEQ---MGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALE
1lk9A           -------------------------------SGSRFGWALIKDESVNNLLNYMTKNTEGTPRETQLRSLK
1v8dA           ----------------------------------------------------------------------
1agxA           LRNAEQPDDKY-----GWIAAHDLNPQKARLMALALTKTNDAKEIQNMF---------------------
1gbnA           TGRWLAVDY-------ENVRPDIVLLGKALSGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVALE
2igsA1          QEIANGVTIGFKERVCNVEILPLLTSXAQNLDRIKARFGSGYLDRFKG----------------------
1gr0A2          ----------------------------------------------------------------------
1gpcA           EGANFVLKVKVSGFSNYDEQSAIPNIDDES-FQKELFEQMVDLSEM------------------------
2fn6A1          YQNKKVGGFALAS-------VFSFHAIKPITTAEGGAVVTNDSELHEKMKLFRSHGMLKKD---------
1ei7A           NRSSFESSSGL-----------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1ynfA1          ----------------------------------------------------------------------
1jg8A           FNASIASGVPVKEYAGYADSVMFCLSXGLCAPV-------------------------------------
1vk9A           SFLLKXKPDHI---HAKVISKPALKLXN--EYGQSFSYDEKIPFVLGKD---------------------
1elqA           ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1c4kA2          NSSPLLI---DDLGPEDPGIIVVQSVHKQQ-AGFSQTSQIHKKDSH------------------------
1o61A           ----------------------------------------------------------------------
1bs0A           GEQGRGS-------CWLQKVLLVVTFGKGF--GVSGAAVLCSSTVADYLLQ-------------------


                         .         *         .         .         .         .         +:350
query           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
1vp4A           YLERYLLEQLKPTIELYRRKRTVXLNALEEYFSDGVKWVKSEGGLFIWLTLPEGFDTWEXFEYAKRKKVF
1u08A           MLRAE-PEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVSTLDDVEFCQWLTQEHGVA
1b8gA           LSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSG--ISCLNGNAGLFCWVDMRFEAEMELWKKIVYEVHLN
1cl1A           GLRTL--GVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSELANYLDNFSLFSMA
1fg3A           LSPQGI-VAXRERVAQIIAEREYLIAALKE--IPCVEQVFDSETNYILARFK---ASSAVFKSLWDQGII
1aamA           ALRAIWEQELTDMRQRIQRMRQLFVNTLEKGANRDFSFIIKQNGMFSFS----GLTKEQVLRLREEFGVY
1b5oA           ALTNQ-------EASRAFVEMAREAYRRRRDLLLELKAVRPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
1d2fA           IAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYWLDLRPLNIDDNALQKALIEQEKVA
1c7nA           ICYKECGKWLDGCIKVIDKNQRIVKDFF-EVNHPEIKAPLIEGTYWIDFRALKMDHKAMEEFMIHKAQIF
1bw0A           AALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGELAPTMPRGAMYLMKYRDIKTDVEFFEKLLEEENVQ
2gb3A1          GLLNLDDSFFDFVRETYRERVETVLKKLEEH--GLKRFTKPSGAFYITAELPEFARWXLTDFNXDGETTX
1c8nA           ----------------------------------------------------------------------
1dtyA           AANASLAILESGDWQQQVADEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVW
1vefA1          AIRY---LERTRLWERAAELGPWFMEKL-RAIPSPKIREVRGMGLMVGLELK-EKAAPYIARLEKEHRVL
1qz9A           PSNGIARYLCGTQPITSLAMVECGLDVFAQTDMASLRVTPREHAKRGSHVSFEHPEGYAVIQALIDRGVI
1lc5A           ALQDSA--WQQATWHWLREEGARFYQAL-CQLPLL--TVYPGRANYLLLRCER--EDIDLQRRLLTQRIL
1h1cA           ALD--HREIFEERTKFIVEERERXKSALRE---XGYRITDSRGNVFVFXEKEE---KERLLEHLRTKNVA
2bwnA1          GAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLSDYGVY
1v72A1          YLTDD-----LWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLD-----SAMIDALLKAGFG
1iugA           AWTPAINLPRLEEHLALKAWQNALLYGV-GEEGGLRPVPKRFSPAVAAFYLPEGVPYARVKEAFAQRGAV
1h0cA           LLALIAEQGLENSWRQHREAAAYLHGRLALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHDIE
1fc4A           KVLEXVEAGSELRD-----RLWANARQFREQXSAAGFTLAGADHAIIPVXLGDAVVAQKFARELQKEGIY
1pmmA           LGREGYTKVQNASYQVAAYLADEIAKLGPYEFTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQ
1b9hA           RAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAIPGLTEERRNALVDRLVEAGLP
1ohvA           VINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQFISRVRGRG-TFCSFDTPDESIRNKLISIARNKGVM
2govA1          ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
3bc8A1          SLCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGKAVTQLGSMLFTRQVS
2e7iA1          LMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKGDNPHNHDLMFFHAEVLYEISKKAKGGRFFLYREL
1s2bA           ----------------------------------------------------------------------
1mdoA           IALAQLQKLDALNARRAAIAAQADLPFQPLSLPSWEHIHAWHLFIIRVDEARCGITRDALXASLKTKGIG
1cs1A           GLRT------------------------------------------------------------------
1c0nA           APWRFEAGTPNTG-------GIIGLGAALEYVSALLTLYGPQARLGVIAFNLGAHHAYDVGSFLDNYGIA
2cfbA1          LSRPGSYEHLDRITGKLVQGLLDAAREFGHEVMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIY
1w9gA1          ----------------------------------------------------------------------
1sf2A           VLKVFEQENLLQKANDLGQKLKDGLLAIAEKEIGDVRGLGAMIAIELFEDGDHNKPTAEIVARARDKGLI
1lk9A           VLKEVVAMVKTQKGTMRDLNTFERWVNITALLDQSDRFPQSEYCNYFRRMRPPSPEDKDCYQTFQNGRIN
1v8dA           ----------------------------------------------------------------------
1agxA           ----------------------------------------------------------------------
1gbnA           VLEE------ENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNIVIKETKDWDAWKVCLRLRDNGLL
2igsA1          ----------------------------------------------------------------------
1gr0A2          ----------------------------------------------------------------------
1gpcA           ----------------------------------------------------------------------
2fn6A1          ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1ynfA1          ----------------------------------------------------------------------
1jg8A           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
1elqA           ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1c4kA2          ----------------------------------------------------------------------
1o61A           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FVPGGPFFANGGGENTLRLSYATLDREGIAExxxxxxxxxxxxxxxx
1vp4A           YVPGRVFKVYDEPSPSXRLSFCLPPDEKIVE----------------
1u08A           AIPLSVFCADPFPHKLIRLCFAK------------------------
1b8gA           ISPGSSC--HCTEPGWFRVCFANLPERTLDL----------------
1cl1A           YSWGGYESLILANQPEHIAAIRPQGEIDFSG----------------
1fg3A           LRDQNKQ---PSLSGCLRITVGT------------------------
1aamA           AVASG------------RVNVAGMTPDNMAP----------------
1b5oA           VVPGTDF----AAFGHVRLSYAT------------------------
1d2fA           IMPGYTY--GEEGRGFVRLNAGCPRSK--------------------
1c7nA           FDEGYIF--GDGGIGFERINLAAPSSV--------------------
1bw0A           VLPGTIF----HAPGFTRLTTTRPVEV--------------------
2gb3A1          VAPLRGFYLTGLGKKEIRIACVLEKDL--------------------
1c8nA           -----------------------------------------------
1dtyA           IRPFGKLI-------YLMPPYIILPQQ--------------------
1vefA1          ALQAGP--------TVIRFLPP-------------------------
1qz9A           GDYREP--------RIMRFGFTPL-----------------------
1lc5A           IRSC--ANYPGLDSRYYRVAIRS------------------------
1h1cA           VRSFREGV---------RITIGK------------------------
2bwnA1          VQPIN-FPTVPRGTERLRFTPPVHDLKQIDG----------------
1v72A1          FYHDRWG----PNVVRFVTSFAT-TAEDVDH----------------
1iugA           IAGGQGP----LKGKVFRLSMGAYDRYEALG----------------
1h0cA           IMGGLGPSTGKVLR-IGLLGCNA------------------------
1fc4A           VTGFF-YPVVPKGQARIRTQSAAHTPEQITR----------------
1pmmA           VPAFT-LGGEATDIVVMRIM---------------------------
1b9hA           AFAAFRAIDAFWELGAPDESVDAIAR---------------------
1ohvA           LGGCGD--------KSIRFRPLVFRDHHAHL----------------
2govA1          -----------------------------------------------
1xl7A1          -----------------------------------------------
1fhlA           -----------------------------------------------
3bc8A1          GARAVPLGNVQTVSGHTFRGFMSHADN--------------------
2e7iA1          KSRKIHGIKPGLTR-YFKLSTYGLSDEEV------------------
1s2bA           -----------------------------------------------
1mdoA           TGLHFRAATEWNSERICSLPFPDXTESDFDR----------------
1cs1A           -----------------------------------------------
1c0nA           VRTGHHCAAYYNVPAMCRASLAYNTHEEVDR----------------
2cfbA1          LAPSQFEA--------GFTSLAHTEAD--------------------
1w9gA1          -----------------------------------------------
1sf2A           LLSCGPY------YNVLRILPLTIEDAQIRQ----------------
1lk9A           TQNGVGF---EASSRYVRLSLIKTQDQLMY-----------------
1v8dA           -----------------------------------------------
1agxA           -----------------------------------------------
1gbnA           AKPTHG--------DIIRFAPLVIKEDELRE----------------
2igsA1          -----------------------------------------------
1gr0A2          -----------------------------------------------
1gpcA           -----------------------------------------------
2fn6A1          -----------------------------------------------
1ei7A           -----------------------------------------------
1qz8A           -----------------------------------------------
1ynfA1          -----------------------------------------------
1jg8A           -----------------------------------------------
1vk9A           -----------------------------------------------
1elqA           -----------------------------------------------
1svvA           -----------------------------------------------
1c4kA2          -----------------------------------------------
1o61A           -----------------------------------------------
1bs0A           -----------------------------------------------