[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80551.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wh0A.bssp"
#ERROR : Can't open dsspfile "1gmeA.bssp"
#ERROR : Can't open dsspfile "1rl1A.bssp"
#ERROR : Can't open dsspfile "1gmeB.bssp"
#ERROR : Can't open dsspfile "1ejfA.bssp"
#ERROR : Can't open dsspfile "1shsA.bssp"
#ERROR : Can't open dsspfile "1xo9A.bssp"

## Summary of PDB Search
:136
    1e-15  18%  1wh0A  [b.15.1.3] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 19
    2e-15  29%  1gmeA  [b.15.1.1] HEAT SHOCK PROTEIN 16.9B
    3e-15  16%  1rl1A  [b.15.1.3] SUPPRESSOR OF G2 ALLELE OF SKP1 HOMOLOG
    3e-14  35%  1gmeB  [b.15.1.1] HEAT SHOCK PROTEIN 16.9B
    5e-14   9%  1ejfA  [b.15.1.2] PROGESTERONE RECEPTOR P23
    5e-12  31%  1shsA  [b.15.1.1] SMALL HEAT SHOCK PROTEIN
    1e-11  16%  1xo9A  [b.15.1.2] HYPOTHETICAL PROTEIN AT3G03773
:136

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxLRKLKELQERIAELAYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPGVRPEDLELLEEGQ
1wh0A           ----------------------------------AFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQ
1gmeA           ----------WADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVKKEEVKVVEDGN
1rl1A           ------------------------------------KIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEK
1gmeB           --------------------------------------RMDWKETPEAHVFKADLPGVKKEEVKVVEDGN
1ejfA           -----------------------------------QPASAKWYDRRDYVFIEFCVEDSKDVNVNF--EKS
1shsA           ----------------------------TGIQISGGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGD
1xo9A           ----------------------------------SRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGL


                         .         .         *         .         .         .         .:140
query           RVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPATxxxxxxx
1wh0A           DFTLIFQTRDGNFLLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQ-------
1gmeA           VLVVSGERTKEKDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTV---------------
1rl1A           ELSALV-----------KLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAV-------
1gmeB           VLVVSGERTKEKDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTV---------------
1ejfA           KLTFSCLG----------GSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGES--------
1shsA           TLEIRAKRSPLMITIIYSEIPEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESS-------
1xo9A           FSFSAL------------GAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEER---------