[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80636.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dliA1.bssp"
#ERROR : Can't open dsspfile "1mfzA2.bssp"
#ERROR : Can't open dsspfile "1mfzA1.bssp"
#ERROR : Can't open dsspfile "1jqkA.bssp"
#ERROR : Can't open dsspfile "1vpdA1.bssp"
#ERROR : Can't open dsspfile "1i36A1.bssp"
#ERROR : Can't open dsspfile "1yrxA1.bssp"
#ERROR : Can't open dsspfile "1dliA2.bssp"
#ERROR : Can't open dsspfile "1dliA3.bssp"
#ERROR : Can't open dsspfile "1jaxA.bssp"
#ERROR : Can't open dsspfile "1mfzA3.bssp"
#ERROR : Can't open dsspfile "1pgjA2.bssp"
#ERROR : Can't open dsspfile "2b0jA2.bssp"
#ERROR : Can't open dsspfile "1evyA2.bssp"
#ERROR : Can't open dsspfile "1js1X2.bssp"
#ERROR : Can't open dsspfile "1emdA1.bssp"
#ERROR : Can't open dsspfile "1txgA2.bssp"

## Summary of PDB Search
:443
    1e-34  29%  1dliA1 [a.100.1.4] UDP-GLUCOSE DEHYDROGENASE A:197 -- 294
    4e-32  31%  1mfzA2 [c.2.1.6] GDP-MANNOSE 6-DEHYDROGENASE A:1 -- 202
    1e-23  23%  1mfzA1 [a.100.1.4] GDP-MANNOSE 6-DEHYDROGENASE A:203 -- 300
    4e-21  13%  1jqkA  [e.26.1.2] CARBON MONOXIDE DEHYDROGENASE
    5e-19  15%  1vpdA1 [a.100.1.1] TARTRONATE SEMIALDEHYDE REDUCTASE A:164 -- 296
    6e-19  15%  1i36A1 [a.100.1.8] CONSERVED HYPOTHETICAL PROTEIN MTH1747 A:153 --
    1e-18  10%  1yrxA1 [d.58.10.2] HYPOTHETICAL PROTEIN RSPH03001874 A:17 -- 130
    4e-17  20%  1dliA2 [c.2.1.6] UDP-GLUCOSE DEHYDROGENASE A:1 -- 196
    5e-14  18%  1dliA3 [c.26.3.1] UDP-GLUCOSE DEHYDROGENASE A:295 -- 402
    1e-09  11%  1jaxA  [c.2.1.6] CONSERVED HYPOTHETICAL PROTEIN
    1e-09  24%  1mfzA3 [c.26.3.1] GDP-MANNOSE 6-DEHYDROGENASE A:301 -- 436
    2e-09  10%  1pgjA2 [c.2.1.6] 6-PHOSPHOGLUCONATE DEHYDROGENASE A:1 -- 178
    2e-07  12%  2b0jA2 [c.2.1.6] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
    1e-04  12%  1evyA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE A:9 -- 197
    4e-04   6%  1js1X2 [c.78.1.1] TRANSCARBAMYLASE X:164 -- 324
    4e-04  14%  1emdA1 [c.2.1.5] MALATE DEHYDROGENASE A:1 -- 145
    7e-04  15%  1txgA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+] A:1
:443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFAVEKAKVGFRVIGVEQNPRRAELVNRGESYIADVPT
1dliA1          ----------------------------------------------------------------------
1mfzA2          --------------------------------VCAGCLSARGHEVIGVDVSSTKIDLINQGKSPIVEPGL
1mfzA1          ----------------------------------------------------------------------
1jqkA           ----------------------------------------------------------------------
1vpdA1          ----------------------------------------------------------------------
1i36A1          ----------------------------------------------------------------------
1yrxA1          ----------------------------------------------------------------------
1dliA2          ------------------------------------------NEVTIVDILPSKVDKINNGLSPIQDEYI
1dliA3          ----------------------------------------------------------------------
1jaxA           --------------------------------------ATLGHEIVVGSRREEKAEA--KAAEY------
1mfzA3          ----------------------------------------------------------------------
1pgjA2          --------------------------------------AEKGFKVAVFNRTYSKSEEFMKANASAPFAG-
2b0jA2          ----------------------------------------------------------------------
1evyA2          --------------------------------ALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKG
1js1X2          ----------------------------------------------------------------------
1emdA1          ----------------------------------------------------------------------
1txgA2          --------------------------------ALSVPLVDNGNEVRIWGTEFDTEILKSISAGREHPRLG


                         .         .         *         .         .         .         .:140
query           EVLKEVVDKGLLRAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTY
1dliA1          ----------------------------------------------------------------------
1mfzA2          EALQQGRQTGRLSGTTDFKKVLDSDVSFICVGTPSKKNGDLDLGYIETVCREIGFAIREKHTVVVRSTVL
1mfzA1          ----------------------------------------------------------------------
1jqkA           ----------------------------------------------------------------------
1vpdA1          ----------------------------------------------------------------------
1i36A1          ----------------------------------------------------------------------
1yrxA1          ----------------------------------------------------------------------
1dliA2          EYYLKSKQLSIKATLDSKAAYKEAELVIIATPTNYNRINYFDTQHVETVIKEVLSVNSHA-TLIIKSTIP
1dliA3          ----------------------------------------------------------------------
1jaxA           ---RRIAGDASITGMKNEDAAEACDIAVLTIPWE----------HAIDTARDLKNILREKIVVSPLVPVS
1mfzA3          ----------------------------------------------------------------------
1pgjA2          ------NLKAFETMEAFAASLKKPRKALILVQAG---------AATDSTIEQLKKVFEKGDILVDTGNAH
2b0jA2          ---VHPEDVGLKVTSDDREAVEGADIVITWLP---------KGNKQPDIIKKFADAIPEGAIVTHACTIP
1evyA2          VQLASNIT----FTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGG-----NLIAYAKEKQVPVLVCTKGI
1js1X2          ----------------------------------------------------------------------
1emdA1          --------------------LEGADVVLISAGVRRKPGMDRSAGIVKNLVQQVAKTCP--KACIGIITNP
1txgA2          V---KLNGVEIFWPEQLEKCLENAEVVLLGVSTD----------GVLPVMSRILPYLKDQYIVLISKGLI


                         +         .         .         .         .         *         .:210
query           PGTTEEVMLPILEQSGLKVEEDFFLVHSPERVDPGNKRYTTRNTTKVVGGVGPRSLEAGVFFYSQTIEKV
1dliA1          ----------------------------------------------------------------------
1mfzA2          PGTVNNVVIPLIEDSGKKAGVDFGVGTNPEFLRESTAIKDYDFPPTVIGELDKQTGD-------------
1mfzA1          ----------------------------------------------------------------------
1jqkA           ---------QCGFGAGLC---CRICLKGPCRIDPFGEGP-----KYGVCGADRDTIVARHLVRMIAAGTA
1vpdA1          ----------------------------------------------------------------------
1i36A1          ----------------------------------------------------------------------
1yrxA1          ----------------------------------------------------------------------
1dliA2          IGFITEMR---------QKFQTDRIIFSPEFLRESKALYDNLYPSRIIVSCENDSPKVKADAE-------
1dliA3          ----------------------------------------------------------------------
1jaxA           RGAKGFTYSSERSAAEIVAEVKVVSALHTIPAARFANLDEKFDWDVPVCGDDDESKKVVMSLISELRPLD
1mfzA3          ----------------------------------------------------------------------
1pgjA2          FKDQGRRAQQLEAAGLRFL--GMGISGGEEGARKG-----------------------------------
2b0jA2          TTKFAKIFKDL--------GREDLNITSYH---PGCVPEMKGQVYIAEGYASEEAVNKLYEIGKIARGKA
1evyA2          ERSTLKFPAEIIGEFLPSP--LLSVLAGPSFAIEVATGVFTC---VSIASADINVARRLQRIMSTGDRSF
1js1X2          ----------------------------------------------------------------------
1emdA1          VNTTVAIAAEVLKKGVYDKNKLF-----------------------------------------------
1txgA2          DFDNSVLTVPEAVWLKHDLRERTVAITGPAIAREVAKRMP---TTVVFSSPSESSANKMKEIF-ETEYFG


                         .         .         .         +         .         .         .:280
query           VPVSSAKAAELVKVFENTFRAVNIALVNELAMLCDRMGLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIP
1dliA1          -----ASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDIGMHYNNPSFGYGGYCLP
1mfzA2          ----------------------------------------------------------------------
1mfzA1          -------VAEXIKYTCNVWHAAKVTFANEIGNIAKAVGVDGREVXDVICQDHLSRYYXRPGFAFGGSCLP
1jqkA           HSEHGRHIALAMQHSQGELHDYSIRDEAKLYAIAKTLGVATEGRLAIVGDLAAITLGDFQNQDYDKPCAW
1vpdA1          -----IGAGNVTKLANQVIVALNIAAXSEALTLATKAGVNPDLVYQAIRGGLASTVLDAKAPGFRIDLHI
1i36A1          -------DASAIKMLRSSYTKGVSALLWETLTAAHRLGLEVLEMLEYTEGNDFRESAISRSSCIHARRRY
1yrxA1          ----------------------------------------------------------YRSLA-APDLTL
1dliA2          ----------------------------------------------------------------------
1dliA3          ----------------------------------------------------------------------
1jaxA           AGPLSNSRLVESLTPLILNIMRFNGMGEL-----------------------------------------
1mfzA3          ----------------------------------------------------------------------
1pgjA2          ----------------------------------------------------------------------
2b0jA2          FKM-------------------------------------------------------------------
1evyA2          VCWAT-----------------------------------------------------------------
1js1X2          ----------------------------------------------------------------------
1emdA1          ----------------------------------------------------------------------
1txgA2          VEVTT-----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IDPHYLEWKAKEYNFNTHFIALAGEINRKMPEFTVEKALRVLAEAGVPVRGAKVLVLGVAYKRDIPDYRE
1dliA1          KDTKQL--LANYNNIPQTLIEAIVSSNNVRKSY-------------------------------------
1mfzA2          ----------------------------------------------------------------------
1mfzA1          KDVRALTYRASQLDVEHPXLGSLXRSNS------------------------------------------
1jqkA           LAASLTPRRVKRLGLGLLPHNIDASVAQTMSRTHVGCILGGLRVAMADLDGSMLATELSDALFGTPQPVV
1vpdA1          KDLANALDTSHGVGAQLPLTAAVXERADGHGNDDHSALACYYEKLA------------------------
1i36A1          EEMKEVQ-DMLAEVIDPVMPTCIIRIFDKL----------------------------------------
1yrxA1          RDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVEILAEEPIAKRRFAGWHMQLSCSEADMRS
1dliA2          ----------------------------------------------------------------------
1dliA3          -------------------------------------AKQIINVLEQESPVKVVGVYRLIMKSNSDNFRE
1jaxA           ----------------------------------------------------------------------
1mfzA3          -----------------------------------------AFDLITSHDTRKVGLLGLSFKAGTDDLRE
1pgjA2          ----------------------------------------------------------------------
2b0jA2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1js1X2          ---------------------------------------------------------VMTWAPHPRPLPQ
1emdA1          ----------------------------------------------------------------------
1txgA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SPAIEVIRGLRRLGAEVEYHDPHVPRFAEGGLAMESVPLSEERVREKDLVLIATDHSAFDYKAIVAQARR
1dliA1          ----------------------------------------------------------------------
1mfzA2          ----------------------------------------------------------------------
1mfzA1          ----------------------------------------------------------------------
1jqkA           SAANLGVMKRGAVNIAVNGHNPML----------------------------------------------
1vpdA1          ----------------------------------------------------------------------
1i36A1          ----------------------------------------------------------------------
1yrxA1          LGLAESRQIV------------------------------------------------------------
1dliA2          ----------------------------------------------------------------------
1dliA3          SAIKDVIDILKSKDIKIIIYEPMLNK-LESEDQSVLVNDLENFKKQANIIVTNRYDNELDVKNKV-----
1jaxA           ----------------------------------------------------------------------
1mfzA3          SPLVELAEXLIGKGYELRIFDRNVRVHGANKEYIESKIPHDEVVASSDVLVLGNGDELFDLVNKTPSGKK
1pgjA2          ----------------------------------------------------------------------
2b0jA2          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1js1X2          AVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDMKAFEGADFIYAKNWAAYT-----------
1emdA1          ----------------------------------------------------------------------
1txgA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VLDARGxxxxxxxxxxxxxxxxx
1dliA1          -----------------------
1mfzA2          -----------------------
1mfzA1          -----------------------
1jqkA           -----------------------
1vpdA1          -----------------------
1i36A1          -----------------------
1yrxA1          -----------------------
1dliA2          -----------------------
1dliA3          -----------------------
1jaxA           -----------------------
1mfzA3          LVDLVG-----------------
1pgjA2          -----------------------
2b0jA2          -----------------------
1evyA2          -----------------------
1js1X2          -----------------------
1emdA1          -----------------------
1txgA2          -----------------------