[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80664.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cu3A1.bssp"
#ERROR : Can't open dsspfile "1zud21.bssp"
#ERROR : Can't open dsspfile "1tygB.bssp"
#ERROR : Can't open dsspfile "1rwsA.bssp"
#ERROR : Can't open dsspfile "1wgkA.bssp"
#ERROR : Can't open dsspfile "1v8cA1.bssp"

## Summary of PDB Search
:64
    7e-24  97%  2cu3A1 [d.15.3.2] UNKNOWN FUNCTION PROTEIN A:1 -- 63
    2e-08  22%  1zud21 [d.15.3.2] THIS PROTEIN 2:2 -- 66
    2e-07  30%  1tygB  [d.15.3.2] YJBS
    4e-07  22%  1rwsA  [d.15.3.2] HYPOTHETICAL PROTEIN PF1061
    1e-06  25%  1wgkA  [d.15.3.3] RIKEN CDNA 2900073H19 PROTEIN
    2e-05  26%  1v8cA1 [d.15.3.1] MOAD RELATED PROTEIN A:1 -- 87
:64

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG
2cu3A1          -VWLNGEPRPLEGKTLKEVLEEXGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALXQG-
1zud21          -ILFNDQAMQCAGQTVHELLEQLDQRQAGAALAINQQIVPREQWAQHIVQDGDQILLFQVIAGG
1tygB           MLQLNGKDVKWKTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGG-
1rwsA           --RNIEKEIEWRGMKVRDILRAVGFNTESAIAKVNGK----VVLEDDEVKDGDFVEVIPVVSGG
1wgkA           ------------LKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG
1v8cA1          -----------AYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGG