[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80675.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "2r6gF2.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"

## Summary of PDB Search
:369
    9e-13  20%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    1e-11  24%  2r6gF2 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
    5e-09  11%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
    1e-07  26%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    3e-07  16%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
:369

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG1          ----------------------------------------------------------------------
2r6gF2          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG1          ----------------------------------------------------------------------
2r6gF2          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLLL
2r6gG1          -------------------------------------------------------------------AVL
2r6gF2          ---------------------------------------------------------------------G
1tluA           ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
2onkC1          ------------------------------------------------------------------VAGI


                         .         .         .         +         .         .         .:280
query           WAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFR
2r6gG1          SLVALYALFDRLGEYI-PFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFR
2r6gF2          EINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFF
1tluA           --------------------------SLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTF
3dhwA1          ------------------GTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVR
2onkC1          ALLVVFGSSGLIGSFSPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFF


                         .         *         .         .         .         .         +:350
query           RVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVPAIYMYLLAFRGNQFxxxxxxxxxxxxx
2r6gG1          LVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWG-------------
2r6gF2          KITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGAGYTDLLVNYTYRIAFEGGG--------------
1tluA           HRFLPYGVSGVVVISESHLTIHTWGYAAIDLFTCGEDVPWKAFEHLKKALKAKRVHV-------------
3dhwA1          KVLLPEALPGLVNAAT------------------------------------------------------
2onkC1          TVSLPLSVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYERYLSEGL------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxx
2r6gG1          -------------------
2r6gF2          -------------------
1tluA           -------------------
3dhwA1          -------------------
2onkC1          -------------------