[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80689.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a7uA.bssp"
#ERROR : Can't open dsspfile "2dstA1.bssp"
#ERROR : Can't open dsspfile "1iunA.bssp"
#ERROR : Can't open dsspfile "1pjaA.bssp"
#ERROR : Can't open dsspfile "1c4xA.bssp"
#ERROR : Can't open dsspfile "1cqzA2.bssp"
#ERROR : Can't open dsspfile "1j1iA.bssp"
#ERROR : Can't open dsspfile "1r3dA.bssp"
#ERROR : Can't open dsspfile "1b6gA.bssp"
#ERROR : Can't open dsspfile "1bn6A.bssp"
#ERROR : Can't open dsspfile "1mt3A.bssp"
#ERROR : Can't open dsspfile "1qo7A.bssp"
#ERROR : Can't open dsspfile "2puhA1.bssp"
#ERROR : Can't open dsspfile "1azwA.bssp"
#ERROR : Can't open dsspfile "1r1dA.bssp"
#ERROR : Can't open dsspfile "1dwoA.bssp"
#ERROR : Can't open dsspfile "1ju3A2.bssp"
#ERROR : Can't open dsspfile "1ehyA.bssp"
#ERROR : Can't open dsspfile "1i6wA.bssp"
#ERROR : Can't open dsspfile "1m33A.bssp"
#ERROR : Can't open dsspfile "2b61A1.bssp"
#ERROR : Can't open dsspfile "1auoA.bssp"
#ERROR : Can't open dsspfile "1cvlA.bssp"
#ERROR : Can't open dsspfile "1xktA.bssp"
#ERROR : Can't open dsspfile "1imjA.bssp"
#ERROR : Can't open dsspfile "2jbwA1.bssp"
#ERROR : Can't open dsspfile "1hlgA.bssp"
#ERROR : Can't open dsspfile "1ji3A.bssp"
#ERROR : Can't open dsspfile "2vatA1.bssp"
#ERROR : Can't open dsspfile "1lbsA.bssp"
#ERROR : Can't open dsspfile "1q0rA.bssp"
#ERROR : Can't open dsspfile "1kezA.bssp"
#ERROR : Can't open dsspfile "1lnsA3.bssp"
#ERROR : Can't open dsspfile "2fukA1.bssp"
#ERROR : Can't open dsspfile "1uxoA.bssp"
#ERROR : Can't open dsspfile "1jmkC.bssp"
#ERROR : Can't open dsspfile "3b5eA1.bssp"
#ERROR : Can't open dsspfile "1bcr.1.bssp"
#ERROR : Can't open dsspfile "1ac5A.bssp"
#ERROR : Can't open dsspfile "2h1iA1.bssp"
#ERROR : Can't open dsspfile "1l7aA.bssp"
#ERROR : Can't open dsspfile "1qlwA.bssp"
#ERROR : Can't open dsspfile "2i3dA1.bssp"
#ERROR : Can't open dsspfile "2b20A2.bssp"

## Summary of PDB Search
:257
    5e-16  28%  1a7uA  [c.69.1.12] CHLOROPEROXIDASE T
    5e-15  20%  2dstA1 [c.69.1.39] HYPOTHETICAL PROTEIN TTHA1544 A:2 -- 123
    7e-15  18%  1iunA  [c.69.1.10] META-CLEAVAGE PRODUCT HYDROLASE
    4e-14  12%  1pjaA  [c.69.1.13] PALMITOYL-PROTEIN THIOESTERASE 2 PRECURSOR
    6e-14  18%  1c4xA  [c.69.1.10] PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-
    3e-13  25%  1cqzA2 [c.69.1.11] EPOXIDE HYDROLASE A:226 -- 544
    4e-12  22%  1j1iA  [c.69.1.10] META CLEAVAGE COMPOUND HYDROLASE
    5e-12  17%  1r3dA  [c.69.1.35] CONSERVED HYPOTHETICAL PROTEIN VC1974
    2e-11  16%  1b6gA  [c.69.1.8] HALOALKANE DEHALOGENASE
    2e-11  21%  1bn6A  [c.69.1.8] HALOALKANE DEHALOGENASE
    2e-11  16%  1mt3A  [c.69.1.7] PROLINE IMINOPEPTIDASE
    7e-11  13%  1qo7A  [c.69.1.11] EPOXIDE HYDROLASE
    8e-11  18%  2puhA1 [c.69.1.10] 2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE A:4 --
    7e-10  20%  1azwA  [c.69.1.7] PROLINE IMINOPEPTIDASE
    7e-10  19%  1r1dA  [c.69.1.29] CARBOXYLESTERASE
    1e-09  12%  1dwoA  [c.69.1.20] HYDROXYNITRILE LYASE
    3e-09  16%  1ju3A2 [c.69.1.21] COCAINE ESTERASE A:5 -- 351
    6e-09  20%  1ehyA  [c.69.1.11] PROTEIN (SOLUBLE EPOXIDE HYDROLASE)
    8e-09  11%  1i6wA  [c.69.1.18] LIPASE A
    2e-08  21%  1m33A  [c.69.1.26] BIOH PROTEIN
    4e-08  17%  2b61A1 [c.69.1.40] HOMOSERINE O-ACETYLTRANSFERASE A:2 -- 358
    1e-07  11%  1auoA  [c.69.1.14] CARBOXYLESTERASE
    2e-07  19%  1cvlA  [c.69.1.18] TRIACYLGLYCEROL HYDROLASE
    3e-07  13%  1xktA  [c.69.1.22] FATTY ACID SYNTHASE
    4e-07  23%  1imjA  [c.69.1.23] CCG1-INTERACTING FACTOR B
    7e-07  17%  2jbwA1 [c.69.1.41] 2,6-DIHYDROXY-PSEUDO-OXYNICOTINE HYDROLASE A:8
    1e-06  13%  1hlgA  [c.69.1.6] LIPASE, GASTRIC
    2e-06  11%  1ji3A  [c.69.1.18] LIPASE
    4e-06  17%  2vatA1 [c.69.1.40] ACETYL-COA--DEACETYLCEPHALOSPORIN C A:7 -- 382
    5e-06  13%  1lbsA  [c.69.1.17] LIPASE B
    6e-06  26%  1q0rA  [c.69.1.28] ACLACINOMYCIN METHYLESTERASE
    1e-05  13%  1kezA  [c.69.1.22] ERYTHRONOLIDE SYNTHASE
    2e-05   8%  1lnsA3 [c.69.1.21] X-PROLYL DIPEPTIDYL AMINOPETIDASE A:146 -- 550
    6e-05  11%  2fukA1 [c.69.1.36] XC6422 PROTEIN A:3 -- 220
    8e-05   9%  1uxoA  [c.69.1.31] YDEN PROTEIN
    9e-05  17%  1jmkC  [c.69.1.22] SURFACTIN SYNTHETASE
    1e-04  16%  3b5eA1 [c.69.1.14] MLL8374 PROTEIN A:7 -- 215
    2e-04   7%  1bcr.1 [c.69.1.5] SERINE CARBOXYPEPTIDASE II A:- -- - B:- -- -
    2e-04  21%  1ac5A  [c.69.1.5] KEX1(DELTA)P
    3e-04  23%  2h1iA1 [c.69.1.14] CARBOXYLESTERASE A:1 -- 202
    3e-04  12%  1l7aA  [c.69.1.25] CEPHALOSPORIN C DEACETYLASE
    4e-04  18%  1qlwA  [c.69.1.15] ESTERASE
    6e-04  17%  2i3dA1 [c.69.1.36] HYPOTHETICAL PROTEIN ATU1826 A:2 -- 219
    6e-04  36%  2b20A2 [c.69.1.2] ENTEROCHELIN ESTERASE A:151 -- 397
:257

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MARLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPPRXXXXXXXXX
1a7uA           --DLYYEDHGAGQPVVLIHGFPLSGHSWERQSAALLGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
2dstA1          --NLVFDRVGKGPPVLLVAEEASRWPEALPE-----GYAFYLLDLPGYGRTEGPRMAPEELAHFVAGFAV
1iunA           --LTNYHDVGEGQPVILIHGSGPGVSAWRLTIPALSFYRVIAPDMVGFGFTDRPENNYSKDSWVDHIIGI
1pjaA           -----------YKPVIVVHGLFDSSYSFRHLLEYINHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVP
1c4xA           --ASHALVAGQSPAVVLLHGAGHAASNWRPIIPDLANFFVVAPDLIGFGQSEYPETYSWVGMRVEQILGL
1cqzA2          --RLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCKEMV
1j1iA           --ETRYLEAGKGQPVILIHGGGAGAESWRNVIPILAHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDF
1r3dA           --QLHFAPTARTPLVVLVHGLLGSGADWQPVLSHLAQCAALTLDLPGHGTNPAEAVEXIEQ------TVQ
1b6gA           --RAHYLDEGNSDVFLCLHGEPTWSYLYRKMIPVFAGARVIAPDFFGFGKSDKPVDEEDYTFEFHRNFLL
1bn6A           --RMHYVDVGPRTPVLFLHGNPTSSYLWRNIIPHVASHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAF
1mt3A           --YIYYKLCKEKAKLXTXHGGPGXSHDYLLSLRDXTGITVLFYDQFGCGRSEEPDQSKIDYGVEEAEALR
1qo7A           --AALFSEREDAVPIALLHGWPGSFVEFYPILQLFRPFHLVVPSLPGYTFSSGPPLDKDFGLMDNARVVD
2puhA1          --NIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVAGYRVILKDSPGFNKSDVVMDEQRGLVNARAVKGL
1azwA           --TLYFEQNPHGKPVVMLHGGPGGGCNDKMRRFHDPAYRIVLFDQRGSGRSTPHADLVDNTTWDLVADIE
1r1dA           ----PFFFEAGERAVLLLHGFTGNSADVRXLGRFLEGYTCHAPIYKGHGVPPEELVHDDWWQDVXNGYQF
1dwoA           --------KMVTAHFVLIHTICHGAWIWHKLKPALERAGALDMAASGIDPRQIEQINSFDEYSEPLLTFL
1ju3A2          --RLAVDLDGPVPVLLVRNPYDKFDVFAWSTQSTNWGYAVVIQDTRGLFASEGEFVPDEADAEDTLSWIL
1ehyA           --KIHYVREGAGPTLLLLHGWPGFWWEWSKVIGPLEHYDVIVPDLRGFGDSEKPDLNDLSKKAADDQAAL
1i6wA           ------------NPVVMVHGIGGASFNFAGIKSYLVGWSRDKLYAVDFWDKTGTN-YNNGPVLSRFVQKV
1m33A           ---IWWQTKGQGVHLVLLHGWGLNAEVWRCIDEELSHFTLHLVDLPGFGRSRGFGALSLAD-----XAEA
2b61A1          --NVAYQTYGTNNAVLICHALTGDAEPYFDDGRDGWRYFFISSNVLGGCKGTTGPSSINPQTGKPYGSQF
1auoA           --------KPADACVIWLHGLGADRYDFMPVAEALQLLTTRFVLPQAPTRPTINGGYEMPSWYDIKAMSP
1cvlA           ---------ATRYPVILVHGFANVVDYWYGIQSDLQGAKVYVANLSGFQSDDGPNGRGE--QLLAYVKQV
1xktA           --TLMRLNSVQSRPLFLVHPIEGSTTVFHSLASRLS------IPTYGLQCTRAAPLDSIHSLAAYYIDCI
1imjA           --ALFFREALPGSSVLLLHGIRFSSETWQNLLHRLAGYRAVAIDLPGLGHSKEAAAPAPELAPGSFLAAV
2jbwA1          --------PGPHPAVIXLGGLESTKEESFQXENLVLGXATATFDGPGQGEXFEYKRIAGDYEKYTSAVVD
1hlgA           --------SGQRPVVFLQHGLLASATNWISNLPNNSGYDVWLGNSRGNTWARRNLYYMAKYDLPATIDFI
1ji3A           --------RANDAPIVLLHGFTGWGREEMFGFKYWGGYRTYTLAVGPLSSNWDRVCEAYVRFGRTYPGLL
2vatA1          --PVAYKSVSRDNCVIVCHTLTSSAHVTSWWPTLFGRYFIICLNYLGSPFGSAGPCSPDPDAERPYGAKF
1lbsA           ----GASPSSVSKPILLVPGTGTTGPQSFDSNWIPLGYTPCWISPPPFMLN---DTQVNTEYMVNAITAL
1q0rA           --ELWSDDFGDPPALLLVMGGNLSALGWPDEFARRLGLHVIRYDHRDTG---------------------
1kezA           --SLDLVDMADGVTVICCAGTAAISGPHTRLAGALRIAPVRAVPQPGYEEGEPLP-SSMAAVAAVQADAV
1lnsA3          -----------AKELPIVDKAPYRFTHGWTYSLNDRGFASIYVAGVGTRSSDGFQTSGDYQQIYSMTAVI
2fukA1          ----EPDVAVQPVTAIVCHPLSTEGGSMHNKVVTMAGITVVRFNFRSVGTSAGSFDHGEQDDLRAVAEWV
1uxoA           ------------KQVYIIHGYRASSTNHPWLKKRLLGVQADILNXPNPLQPRLEDWLDTLSLYQHTL---
1jmkC           LQDVTIMNQDQEQIIFAFPPVLGYGLMYQNLSSRLPSYKLCAFDFIEEEDKLQPEGPL------------
3b5eA1          --PYRLLGAGKEECLFLLHGSGVDETTLVPLARRIATATLVAARGRIPQEDGFRWFERIDPAAFTNEAAK
1bcr.1          ---------------------------VLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYAFLAKWFER
1ac5A           ----------------------------------------------------------------------
2h1iA1          ----------------------------------------------------------------------
1l7aA           --YAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWHGYATFGMLVRGQQR---SEDTSISPHGHALGWMT
1qlwA           --------RAKRYPITLIHGCCLTGMTWETTPDGRMGYSTYVIDQSGRGRSATDISAIN-----------
2i3dA1          -GRYQPSKEKSAPIAIILHPHPQFGGTVYQLFYLFQGFTTLRFNFRSIGRSQGEFDHELSDAASALDWVQ
2b20A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRAKVESWLHALKTGGTVLRLRV
1a7uA           LETLDLQDAVLVGFSMGGEVARYVSSYGTARIAKVAFLASLE----------------------------
2dstA1          MMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVEVAEVLS----------------------------
1iunA           MDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIEN--MRNLL
1pjaA           IMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICY
1c4xA           MNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYREL
1cqzA2          TFLDKLPQAVFIGHDWAGVMVWNMALFYPERVRAVASLNTPFMPPDPDVSPMKVIRSIP-----------
1j1iA           IKAMNFDGKVIVGNSMGGATGLGVSVLHSELVNALVMGSAGLVVEYDFTREGMVHLVKALTNDGFKIDDA
1r3dA           AHVTSEVPVILVGYSLGGRLIXHGLAQGAFSRLNLRGGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEH
1b6gA           ALIERLDNITLVVQDWGGFLGLTLPMADPSRFKRLIIMNAXLMTDPVTQPAFSAFVTQPADGFTAWKYDL
1bn6A           IEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEF------------------------------
1mt3A           SKLFGNEKVFLXGSSYGGALALAYAVKYQDHLKGLIVSGGLSRLIDELPAKYRDAIKKYGSSGSYPEYQE
1qo7A           QLMKDLSGYIIQGGDIGSFVGRLLGVGFDACKAVHLNLCAMRAPPEGPSIESLSAAEKEGIARMEKFMTD
2puhA1          MDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGPSMFAPMPMEGIKLLFKLYAEPSYETLKQ
1azwA           RLRTHLDRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFLLRRFELEWFYQEGASRL-----------
1r1dA           LKNKGYEKIAVAGLSLGGVFSLKLGYTVPIE--GIVTXCAPXYIKS------------------------
1dwoA           EKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSPSYTVEKLLESFPDWRDTEYFTFTNITGET
1ju3A2          EQAWCDGNVGMFGVSYLGVTQWQAAVSGVGGLKAIAPSMASADLYRAPWYGPGGALSVEALLGWSALIGT
1ehyA           LDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFDPIQPDF-------------------------
1i6wA           LDETGAKKVDIVAHSMGGANTLYYILDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADM
1m33A           VLQQAPDKAIWLGWSLGGLVASQIALTHPERVRALVTVASSPCFSARWPGIKPDVLAGFQQQLSDDQQRT
2b61A1          PNIVVQHLKAIIGGSFGGXQANQWAIDYPDFXDNIVNLCSSIYFSAEAIGFNHVXRQAVI----------
1auoA           ARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGFS-------------------------------
1cvlA           LAATGATKVNLIGHSQGGLTSRYVAAVAPQLVASVTTIGT------------------------------
1xktA           RQVQPEGPYRVAGYSYGACVAFEMCSQLQAQHNSLFLFDGSPTYPGCEAEAETEAICFF-----------
1imjA           VDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVP---------------------------------
2jbwA1          LLTKRNDAIGVLGRSLGGNYALKSAACEPRLAACISWGGFSDLDYWDLETPLTKESW-------------
1hlgA           VKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINKLRFVPQSLFKFIFG
1ji3A           PELKRGGRIHIIAHSQGGQTARMLVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFV-------------
2vatA1          PRTTIRQIAAVVGASMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYLDGEY
1lbsA           YAGSGNNKLPVLTWSQGGLVAQWGLTFFPSIRSKVDRLMAAPDYKGTVLAGPLDAL--------------
1q0rA           ----------------------------------------------------------------------
1kezA           IRTQGDKPFVVAGHSAGALMAYALATELLDRGHPPRGVVLIDVYPPGHQDAMNAWLEE------------
1lnsA3          DWLNGNGKVAMTGKSYLGTMAYGAATTGVEGLELILAAGISSWYNYYRENGLVRSPGGFPGEDLDVLAAL
2fukA1          RAQRPTDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPPAGRWDFSDVQPPAQWLVI-------------
1uxoA           -----HENTYLVAHSLGCPAILRFLEHLQLRAALGGIILVSGFAK-------------------------
1jmkC           ---------TLFGYSAGCSLAFEAKKLEGQGRIVQRIIMVDSYKKQGVSSDVEALMN-------------
3b5eA1          RHGLNLDHATFLGYSNGANLVSSLXLLHPGIVRLAALLRPXPVLDHVPATDLAGIRTLIIAGAADETYGP
1bcr.1          FPHYKYRDFYIAGESYAGHYVPELSQLVHRSKNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGI----
1ac5A           ---------ILSGESYAGQYIPFFANAILNHNKFSKIDGDTYDLKAL-----------------------
2h1iA1          ------NNIVAIGYSNGANIAASLLFHYENALKGAVL---------------------------------
1l7aA           KGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRI--------GVTGGSQGGGLTIAAAALSDIPKAAV
1qlwA           ----------------------------------------------------------------------
2i3dA1          SLHPDSKSCWVAGYSFGAWIGXQLLXRRPEIEGFXSIAPQPNTYDFSFLAPCPSS---------------
2b20A2          ----RADRTVVAGQSFGGLSALYAGLHWPERFGCVLS---------------------------------


                         +         .         .         .         .         *         .:210
query           ALPWVFGRGFLEAHPXXXXXXXXXXXXXXXPTKTAQERLLLGFLTLEDXXXXXXXXXXXXXXXYGTEDLL
1a7uA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1iunA           DIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQV
1pjaA           SPWGQEFSICNYWHD-------------------------------------------------------
1c4xA           IHSFVYDPENFPGEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRI
1cqzA2          ----------------------------------------------------------------------
1j1iA           MINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTL---------------VVQGKDDKV
1r3dA           VLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHXLLATSLAKQPYLLPALQALKLPIHYVCGEQDSK
1b6gA           VTPPTLTEAEASAYAAPFPDTSYQAGVRKFPKMVAQRDQAXIDISTEAISFWQNDWNGQTFMAIGMKDKL
1bn6A           ----------------------------------------------------------------------
1mt3A           AVNYFYHQHLLRSEDWPPEVLKSLEYAERRNXNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEV
1qo7A           GLAAWIGEKYLQWVDKPLPSETILEMVSLYWLTESFPRAIHTYRETTPMLQKELYIHKPFGFSFFPKDLC
2puhA1          MLQVFLYDQSLITEE-LLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRF
1azwA           ----------------------------------------------------------------------
1r1dA           ----------------------------------------------------------------------
1dwoA           ITTMKLGFVLLRENLFTKCTDGEYELAKMVMR---KGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKI
1ju3A2          GL--------------------------------------------------------------------
1ehyA           ----------------------------------------------------------------------
1i6wA           IVMNYLSRLDGARNV-------------------------------------------------------
1m33A           VERFLALQTXGTETARQDARALKKTVLALPXPEVDVLNGGLEILKTVDLRQPLQNVSXPFLRLYGYLDGL
2b61A1          ----------------------------------------------------------------------
1auoA           ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1xktA           ----------------------------------------------------------------------
1imjA           ----------------------------------------------------------------------
2jbwA1          ----------------------------------------------------------------------
1hlgA           DKIFYPHNFFDQFL--------------------------------------------------------
1ji3A           ----------------------------------------------------------------------
2vatA1          DVDDQPVRGLETA---------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1q0rA           ----------------------------------------------------------------------
1kezA           ----------------------------------------------------------------------
1lnsA3          TYSRNLDGADFLKGNAEYEKRLAEMTAALDRKSGDYNQFWHDR----NYLINTDKVKADVLIVHGLQDWN
2fukA1          ----------------------------------------------------------------------
1uxoA           ----------------------------------------------------------------------
1jmkC           ----------------------------------------------------------------------
3b5eA1          FVPALVTL--------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
2h1iA1          ----------------------------------------------------------------------
1l7aA           ADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKV
1qlwA           ----------------------------------------------------------------------
2i3dA1          ----------------------------------------------------------------------
2b20A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FPKAYASNXXXXXXXXXXXXPAGHAAPIEAPLAFARAVRAFLEEVYA
1a7uA           -----------------------------------------------
2dstA1          -----------------------------------------------
1iunA           VPLSSSLRELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNE---
1pjaA           -----------------------------------------------
1c4xA           VPLSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHF-----
1cqzA2          ---------------------CGHWTQIEKPTEVNQILIKWLQT---
1j1iA           VPVAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFL-----
1r3dA           FQQLAESSGLSYSQVAQ----AGHNVHHEQPQAFAKIVQAXIHSI--
1b6gA           LGPDVMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAET---
1bn6A           --------------------PGLHYLQEDNPDLIGSEIARWLPGL--
1mt3A           TPNARVIHEKIAGSELHVFRDCSHLTXWEDREGYNKLLSDFILK---
1qo7A           PVPRSWIATTGNLVFFRDHAEGGHFAALERPRELKTDLTAFVEQVW-
2puhA1          VPLDHGLKWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRH---
1azwA           -----------------------------------------------
1r1dA           -----------------------------------------------
1dwoA           FLPDFQRWANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVAD----
1ju3A2          ---------------------WSHSNLTGRNADRKFGIAATYPIQEA
1ehyA           ---------------------CGHFLMVEKPEIAIDRIKTAFR----
1i6wA           -----------------------------------------------
1m33A           VPRKVVPXLDKLWPHSESYIFAKHAPFISHPAEFCHLLVALKQRVGS
2b61A1          ---------------------YGHDAFLVDYDQFEKRIRDGL-----
1auoA           -----------------------------------------------
1cvlA           -----------------------------------------------
1xktA           -----------------------------------------------
1imjA           -----------------------------------------------
2jbwA1          -----------------------------------------------
1hlgA           -----------------------------------------------
1ji3A           -----------------------------------------------
2vatA1          --------------------NEGHDFFVMEADKVNDAVRGFLDQ---
1lbsA           -----------------------------------------------
1q0rA           ---------------------MGHALPSSVHGPLAEVILAHTRS---
1kezA           -----------------------------------------------
1lnsA3          VTYNFWKALPEGHAKHAFLHRGAHIYMSWQSIDFSETINAYFVA---
2fukA1          -----------------------------------------------
1uxoA           -----------------------------------------------
1jmkC           -----------------------------------------------
3b5eA1          -----------------------------------------------
1bcr.1          -----------------------------------------------
1ac5A           -----------------------------------------------
2h1iA1          -----------------------------------------------
1l7aA           TPVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILK----
1qlwA           -----------------------------------------------
2i3dA1          -----------------------------------------------
2b20A2          -----------------------------------------------